DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33552 and CG14983

Sequence 1:NP_001014488.1 Gene:CG33552 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_647843.1 Gene:CG14983 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster

Alignment Length:150 Identity:47/150 (31%)
Similarity:74/150 (49%) Gaps:21/150 (14%)


  Fly    15 IVEVIKQ-RKRNKEKDEII-KDSFES-KKRLIDL-----RLQL--DKEKNITKELRLRLAAQDAI 69
            ||:::|: :::.||..||| ::||.| ::||..|     |:.|  .:..||...|:..|...:..
  Fly     7 IVDLLKELQEQEKEIQEIILEESFASPEQRLAQLESVTSRMHLYHSRRGNILMSLQQELGKYEYF 71

  Fly    70 ANQAENLSMKRKKIAEENK----------CYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQR 124
            .....:::.....:...||          |.||....|..|.|..||::||||||.:||.:.|:.
  Fly    72 TLLVRHIAQTHSYLKSLNKALDFLYKVNICSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVLRE 136

  Fly   125 NKTCPICKSQMIRCMDVRII 144
            :..||.| |:..|..:||.|
  Fly   137 SSRCPTC-SRRARHHEVRRI 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 22/55 (40%)
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 19/44 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C329675485
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2623
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1451258at2759
OrthoFinder 1 1.000 FOG0001388
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.