DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33552 and CG17329

Sequence 1:NP_001014488.1 Gene:CG33552 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_609784.2 Gene:CG17329 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster

Alignment Length:134 Identity:43/135 (32%)
Similarity:70/135 (52%) Gaps:9/135 (7%)


  Fly     3 KQDITKMTKKKLIVEVIKQRKRNKEKDEIIKDSFESKKRLIDLRLQLDKEKNITKELRL-RLAAQ 66
            :|:.|:.:...|..:|.|.|..|..    :|.....::|::.| ||....:..|.|.|| |:...
  Fly    15 QQEPTEPSNGNLEEQVRKLRDHNLR----VKHLNTQRRRILRL-LQGKMLQYATLEERLHRIGEL 74

  Fly    67 DAIA---NQAENLSMKRKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTC 128
            ..||   :..:.|:.:..::.|.:.|.||...:...|.||.||::||||||::||...::||..|
  Fly    75 VLIAELHSGVKTLNQRLDRMVENSTCSICLLPWTDNGIHRLVSLRCGHLFGSSCIHMAIRRNHRC 139

  Fly   129 PICK 132
            |||:
  Fly   140 PICR 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 22/45 (49%)
CG17329NP_609784.2 zf-RING_2 99..143 CDD:290367 22/44 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C329675435
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2623
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1451258at2759
OrthoFinder 1 1.000 FOG0001388
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR16047
RoundUp 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.