DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33552 and CG31807

Sequence 1:NP_001014488.1 Gene:CG33552 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_723984.1 Gene:CG31807 FlyBaseID:FBgn0051807 Length:155 Species:Drosophila melanogaster

Alignment Length:155 Identity:50/156 (32%)
Similarity:83/156 (53%) Gaps:24/156 (15%)


  Fly     4 QDITKMTKKKLIVEVIKQRKRNKEKDEIIKDSFESKKRLIDLRLQL-DKEKNITKELRLRLAAQD 67
            :.:.:|.||.::.:::.:||::::||          |:|..|.:.. :|:|...:||:|....::
  Fly     9 RSLMRMLKKDVVEQLLAERKKSEQKD----------KQLAKLNITTQEKDKMREEELKLYYQMEE 63

  Fly    68 AIANQ-----------AENLSMKRKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHY 121
            .|.||           .:.|:.:.:|||.||.|.||...:|....||.||::||||||..||..:
  Fly    64 EITNQKLLQEQLLFESKDELTQQLEKIAIENTCCICLDPWEAKDHHRLVSLRCGHLFGEMCIRTH 128

  Fly   122 LQRNKTCPICKSQMIRCMDV-RIII 145
            ||....||||:...|. .|| |:::
  Fly   129 LQHADMCPICRKVAIE-RDVWRVLL 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 23/45 (51%)
CG31807NP_723984.1 zf-RING_2 94..139 CDD:290367 23/45 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C329675293
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2623
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1451258at2759
OrthoFinder 1 1.000 FOG0001388
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR16047
RoundUp 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.