DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33552 and Rnf128

Sequence 1:NP_001014488.1 Gene:CG33552 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001166820.1 Gene:Rnf128 RGDID:1566282 Length:428 Species:Rattus norvegicus

Alignment Length:110 Identity:29/111 (26%)
Similarity:54/111 (49%) Gaps:10/111 (9%)


  Fly    36 FESKKRLIDLRLQLDKEKNITKELRLRLAAQDAIAN-QAENLSMKRKKIAEE-NKCYICKWNYEV 98
            |.|.:||.:.|.|..|::      :|:..|:.||.. |...|....|:|..: :.|.:|...|:.
  Rat   228 FYSARRLRNARAQSRKQR------QLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCAVCIELYKP 286

  Fly    99 TGDHRPVSIKCGHLFGANCILHYLQRNKTCPICKSQMIRCMDVRI 143
            ....|  .:.|.|:|...|:..:|..::|||:||..:::.:.:.:
  Rat   287 NDVVR--ILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEV 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 13/45 (29%)
Rnf128NP_001166820.1 PA_GRAIL_like 48..193 CDD:239037
zf-RING_2 275..318 CDD:290367 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.