DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33552 and Rnf4

Sequence 1:NP_001014488.1 Gene:CG33552 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001291198.1 Gene:Rnf4 MGIID:1201691 Length:194 Species:Mus musculus

Alignment Length:143 Identity:30/144 (21%)
Similarity:60/144 (42%) Gaps:22/144 (15%)


  Fly     5 DITKMTKKKLIVE--------VIKQRKRNKEKDEIIKDSFESKKRLI--DLRLQLDKEKNITKEL 59
            |:|..:.:.::|:        ::::|:|.:.....::........:.  |..|..||:..:|...
Mouse    52 DLTCESLEPVVVDLTHNDSVVIVEERRRPRRNGRRLRQDHADSCVVSSDDEELSRDKDVYVTTHT 116

  Fly    60 RLRLAAQDAIANQAENLSMKRKKIAEENKCYICKWNY-EVTGDHR-PVSIKCGHLFGANCILHYL 122
            . |....|.......:.::         .|.||...| |:..:.| .||.:|||:|.:.|:...|
Mouse   117 P-RSTKDDGATGPRPSGTV---------SCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSL 171

  Fly   123 QRNKTCPICKSQM 135
            :...|||.|:.::
Mouse   172 KNANTCPTCRKKI 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 18/47 (38%)
Rnf4NP_001291198.1 Required for ubiquitination activity 1..20
Mediates interaction with TRPS1. {ECO:0000269|PubMed:12885770} 6..65 3/13 (23%)
SUMO interaction motif 1, mediates the binding to polysumoylated substrates. {ECO:0000250|UniProtKB:P78317} 40..43
SUMO interaction motif 2, mediates the binding to polysumoylated substrates. {ECO:0000250|UniProtKB:P78317} 50..53 1/1 (100%)
SUMO interaction motif 3, mediates the binding to polysumoylated substrates. {ECO:0000250|UniProtKB:P78317} 61..63 0/2 (0%)
SUMO interaction motif 4, mediates the binding to polysumoylated substrates. {ECO:0000250|UniProtKB:P78317} 71..74 0/3 (0%)
zf-RING_2 135..181 CDD:290367 18/46 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001388
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.