DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-II and MERTK

Sequence 1:NP_001014485.3 Gene:side-II FlyBaseID:FBgn0259213 Length:1064 Species:Drosophila melanogaster
Sequence 2:NP_006334.2 Gene:MERTK HGNCID:7027 Length:999 Species:Homo sapiens

Alignment Length:362 Identity:83/363 (23%)
Similarity:140/363 (39%) Gaps:71/363 (20%)


  Fly   328 LSFVPTTDDDGKSITCRAENPNVNGLYLETMWKLNVVYPPLVTLRLGSTLTPDDIKEGDDVYFEC 392
            |.|.||  ..|:..|.....|.|.          :|...||..|....|:....:.|...|.|.|
Human    63 LMFSPT--QPGRPHTGNVAIPQVT----------SVESKPLPPLAFKHTVGHIILSEHKGVKFNC 115

  Fly   393 HV-------QSNPQW----RKLLWLHNGI---HLEHNTSARVIRSNQSLVLQKITKHYAGNYACS 443
            .:       .:...|    ::||..|:.|   :.:...:|.:    .|..:..:.:...|:|.|.
Human   116 SISVPNIYQDTTISWWKDGKELLGAHHAITQFYPDDEVTAII----ASFSITSVQRSDNGSYICK 176

  Fly   444 -AINDEGETVSNQLPLRVKYTP-MCKHADRVILIGASKDETVEVVCEIQADPPPRTFRWKFNNSG 506
             .||:| |.||:.:.:.|:..| ..|..:.   :..:::....:.|:....|.|....|..|:| 
Human   177 MKINNE-EIVSDPIYIEVQGLPHFTKQPES---MNVTRNTAFNLTCQAVGPPEPVNIFWVQNSS- 236

  Fly   507 ETLDVGSERFSVN----GSRSILKYTPVTDQDYGTLSCWASNEVGTQQHPCLFQVVLAALPNAVS 567
                      .||    .|.|:|....:|:.  ...||.|.|:.|......: |:.:.|:|:..:
Human   237 ----------RVNEQPEKSPSVLTVPGLTEM--AVFSCEAHNDKGLTVSKGV-QINIKAIPSPPT 288

  Fly   568 NCTVFNRTELSVDIQCIPGYDGGLP----QIFVLEMFSTRTG-ITRFNLSNAEEALFSLENLDTL 627
            ..::.|.|..|:.|..:||:||..|    .|.|.|......| :..||.| |...|:.::.|..|
Human   289 EVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTS-ALPHLYQIKQLQAL 352

  Fly   628 TSMMVQENNSLRLRIYSYNQKGRSAAYLLTDFIIGST 664
            .:..:        .:...|:.|.||   ::.:|:.||
Human   353 ANYSI--------GVSCMNEIGWSA---VSPWILAST 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-IINP_001014485.3 IG_like 55..160 CDD:214653
Ig 57..160 CDD:299845
Ig 188..251 CDD:299845
Ig 289..363 CDD:299845 8/35 (23%)
IG_like 289..351 CDD:214653 8/23 (35%)
Ig_2 376..460 CDD:290606 21/99 (21%)
IG_like 383..454 CDD:214653 20/86 (23%)
Ig 470..548 CDD:299845 17/82 (21%)
IG_like 481..557 CDD:214653 18/80 (23%)
MERTKNP_006334.2 IG 111..193 CDD:214652 19/87 (22%)
Ig 111..176 CDD:143165 13/69 (19%)
Ig2_Tyro3_like 199..279 CDD:143226 19/97 (20%)
IG_like 203..280 CDD:214653 18/94 (19%)
FN3 284..378 CDD:238020 27/106 (25%)
FN3 386..478 CDD:238020
PTKc_Mer 579..862 CDD:271106
Pkinase_Tyr 587..854 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.