DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Unc-89 and Mylk3

Sequence 1:NP_001097440.1 Gene:Unc-89 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_001104280.1 Gene:Mylk3 RGDID:1305801 Length:786 Species:Rattus norvegicus

Alignment Length:539 Identity:152/540 (28%)
Similarity:232/540 (43%) Gaps:115/540 (21%)


  Fly  2967 GLAQAP-QFLLREQDISYGVKDHNTELMWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQAT 3030
            |.|:|| ...:.|..|..|.:...          |.||.:       ..:||...:..|..|...
  Rat   344 GSAEAPGPGTVLEDQIPKGARPFP----------PLPKRS-------CNNGGASAEEATGPGAEP 391

  Fly  3031 LFINKMLDRDVGWY-EAVATNEHGEARQRVRLEIAEHP---RFLKRPDETFIMARKNGRIEAKLV 3091
            :....::.||  |. |.|.|.:..:.|...  .::..|   ...:.|..|....|.:...||.:|
  Rat   392 IRGPSLVTRD--WRDEPVGTTDLQQGRDPG--AVSPEPGKDHAAQGPGRTEAGRRVSSAAEAAIV 452

  Fly  3092 GIPLPEVHWFKDWKPIVDSSRIKISSYDPDIYVLSIHDSIIKDGGLYSISARNIAGSISTSVTVH 3156
                           ::|.|....:.::.  .|:||.|::                 ||||.|| 
  Rat   453 ---------------VLDDSAAPPAPFEH--RVVSIKDTL-----------------ISTSYTV- 482

  Fly  3157 IEENEDQYIYKTYGRHPYVRSKQLRYQDKYDIGDELGRGTQGITYHAVERSSGDNYAAKI----- 3216
                         .:|                 :.||.|..|..:...|||:|...||||     
  Rat   483 -------------SQH-----------------EVLGGGRFGQVHRCTERSTGLALAAKIIKVKN 517

  Fly  3217 MYGRPELRPFMLNELEMMNTFNHKNLIRPYDAYDTDRSVTLIMELAAGGELVRDNLLRRDYY-TE 3280
            :..|.:::    ||:.:||..:|.|||:.|||:::..|.|||||...||||. |.:....|: ||
  Rat   518 IKDREDVK----NEINIMNQLSHVNLIQLYDAFESKNSFTLIMEYVDGGELF-DRITDEKYHLTE 577

  Fly  3281 RDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDIIKVSDFGLSRKINRHNLSTLDYGM 3345
            .|:..:.||...|:.::|:..:.|:.|..:::|.....|..||:.||||:|:........:::|.
  Rat   578 LDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVSQTGHQIKIIDFGLARRYKPREKLKVNFGT 642

  Fly  3346 PEFVSPEVVNKEGVNFSHDMWTVGLITYVLLGGHNPFLGIDDRETLTKIREGRWDFKDEIWTHIS 3410
            |||::|||||.|.|:|..|||:||:|||:||.|.:||||..|.||:..|....|||..:.:..:|
  Rat   643 PEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFKGLS 707

  Fly  3411 DDGRDFISRLLLYSPEERMDVKTALKHPWFFMLDRPVYDHDYQIGTDRLRNYYDHFRDWYANASC 3475
            ::.:||:||||:.....||.....|||.|...|.......:.::.:..|...|...|.|      
  Rat   708 EEAKDFVSRLLVKEKSCRMSATQCLKHEWLNHLIAKASGSNVRLRSQLLLQKYMAQRKW------ 766

  Fly  3476 KNYF-------RRRRLSGC 3487
            |.:|       |.|:...|
  Rat   767 KKHFHVVTAVNRLRKFPTC 785

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Atrophin-1 <493..690 CDD:331285
TonB_N 502..>596 CDD:318287
I-set 1017..1108 CDD:333254
I-set 1123..1212 CDD:254352
I-set <1236..1299 CDD:333254
I-set 1313..1403 CDD:254352
Ig_3 1406..1487 CDD:316449
I-set 1499..1595 CDD:254352
I-set 1599..1690 CDD:333254
I-set 1694..1786 CDD:254352
I-set <1836..1903 CDD:333254
I-set 1922..2005 CDD:333254
I-set 2018..2108 CDD:333254
I-set 2113..2214 CDD:333254
I-set 2220..2302 CDD:254352
I-set 2318..2408 CDD:254352
I-set 2415..2506 CDD:254352
I-set 2519..2608 CDD:254352
I-set 2615..2696 CDD:254352
I-set 2717..2805 CDD:254352
FN3 2834..2925 CDD:238020
I-set <2996..3063 CDD:333254 14/68 (21%)
I-set 3067..3157 CDD:333254 19/93 (20%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 101/264 (38%)
I-set 3654..3744 CDD:333254
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
Mylk3NP_001104280.1 STKc_MLCK3 477..737 CDD:271094 107/296 (36%)
S_TKc 485..737 CDD:214567 102/274 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.