DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and Mylk

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_001099344.2 Gene:Mylk / 288057 RGDID:1310915 Length:1961 Species:Rattus norvegicus


Alignment Length:2847 Identity:584/2847 - (20%)
Similarity:955/2847 - (33%) Gaps:1004/2847 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   986 SRASYSVAESRAGIRSSSRLQEDRPLRSVDKPVVVKMLKSVQVEPGETAHFEIQFKDQP-GLVTW 1049
            |:.|:||..||.   ||..|.|        .|..:...:::.|:.|.||.||.:.:..| ..|||
  Rat    22 SKTSHSVDPSRV---SSLPLTE--------APAFILPPRNLCVKEGATAKFEGRVRGHPEPQVTW 75

  Fly  1050 LKDNKPLEDRLADRITQTAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAV------ 1108
            .::.:.:.:  ..|.........::.|.|:...|.|.|.||..|.:.|....|:.:|.|      
  Rat    76 HRNGQTITN--GGRFLLDGGVRGTFSLVIRGVREEDKGKYTCEASNGSGARQVTVELTVEGDLMK 138

  Fly  1109 --GQA--------PGHDETKTN----TEPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKD 1159
              ||.        ||  ||:.:    ..|.|...|..|.:.|..:.||..||.|.|.|:|.:.|.
  Rat   139 KHGQPVLSKASGFPG--ETRPSIWGECPPKFATKLGRAVVKEGQMGRFSCKITGRPPPQVTWLKG 201

  Fly  1160 EKEILETNDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATNKHGEANCEAIATTVEDKNPFG 1224
            ... |:.:.|:. :.:|:  |...|.|.:|.:.|.|||:|...|..|:|                
  Rat   202 NVP-LQPSARVS-MSEKN--GMQILEIHEVTQDDMGTYTCMVVNGSGKA---------------- 246

  Fly  1225 ALSGQILPAGEKPVFQWKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTG 1289
            ::|.::...|.....:..|..::..|:.|.:|..|..:|          ||      .||::.  
  Rat   247 SMSAELSIPGLDNATRLSRGTKDPSPDIRKEVTNGISKD----------PE------TVAESK-- 293

  Fly  1290 NISCSAELSVQGAIQTLNREPEKPTLVIEHREANASIGGSAILELQ------CKGFPKPAVQWKH 1348
              :||:              |:|...:       |....|.:..||      |:..|:..:|   
  Rat   294 --NCSS--------------PQKSNFL-------AQATNSHLKSLQQPKLKPCEDSPRKVLQ--- 332

  Fly  1349 DGEVIQVDDRHKFMYEDEESMSLVIKNVDTVD-----AGVYTIEAINELGQDESSINLVVKAPPK 1408
             ..|:|            ::.|.::.....|.     ||:    ..:..|::..|:....:|.|.
  Rat   333 -SSVLQ------------KTSSTIVLQASKVQPEVRAAGI----GASGPGEERKSLTAPRQATPP 380

  Fly  1409 IKKITDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEI 1473
            .::     |..|.::                  ..|.:|                          
  Rat   381 TRQ-----CGLGGSV------------------GNKFIT-------------------------- 396

  Fly  1474 KLSQAGNYSIKATNDLSQTSEYWSCTVKSKPVIVKNFESEYIHGEKENVQMTVRIDAYPEAKLTW 1538
                 ||..|:...: |:..::     :|:|      :|:.: .|.:.|:.|..:...|:.::.|
  Rat   397 -----GNIPIENQRE-SRFPKF-----ESQP------QSQEV-TEGQTVKFTCEVSGIPKPEVGW 443

  Fly  1539 YHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQL------LIKC 1597
            :.:...::..:....:..||.::.|.:..|...|:|:|:..|:|..|..:.|..|      |.:.
  Rat   444 FLEGIPVRRQEGIVEIYEDGTSHYLCLPRAGTRDSGRYSCTASNTLGQVSCSWTLRVDRPSLTQT 508

  Fly  1598 APEFTHKLKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQ 1662
            ||.|:..||:..|.||...| |...|...|.|...|.::|..|...|:    :.|..:.:|.:..
  Rat   509 APSFSSVLKDSVVIEGQDFV-LRCSVRGTPAPQVTWLLNGQPIQFARS----ICEAGEAELHIQD 568

  Fly  1663 VATNMQGNYTCKIMNDYGKLEDNCVVTVNCK-------------------PKVKRGLKNVEVQEG 1708
            .....:|.|||...|..|::..:..|||..|                   |...:||.:::|.:|
  Rat   569 ALPEDRGTYTCLAENALGQVSCSATVTVQEKKGEGERAHRLPPAPSKLFAPIFLQGLSDLKVMDG 633

  Fly  1709 KSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRD---TQRIENYYLTLNLARTEDAGTYEMK 1770
            ...|:.|:|...|..::.|..||:||.|      |.|   .|:...:.|.:.....||.|||..:
  Rat   634 SQVTMTVQVSGNPPPEVIWLHDGNEIQE------SEDFHFEQKGGWHSLCIQEVFPEDTGTYTCE 692

  Fly  1771 ATNFIGETTSTCKVAVLTSEALSLEQTVTKTLIATTEEPEEGAVPEIVHVDVFQQHSY-ESVPLK 1834
            |.|..||                    |....|.|.:||.:|..|..:........|. :||.:.
  Rat   693 AWNSAGE--------------------VRTQAILTVQEPHDGTQPWFISKPRSVTASLGQSVLIS 737

  Fly  1835 YEVIATGIPKPEAIWYHDGKPITPDK-HTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKS 1898
            ..:  .|.|.|...|..|||.::.|. |..:..:.|.:.|.::::....||:|:::::|:|||.|
  Rat   738 CAI--AGDPFPTVHWLRDGKALSRDHGHFELLQNEDVFTLVLKNVQPWHAGQYEILLKNRVGECS 800

  Fly  1899 HQGELSL-SGIAEY-----RKPILTQGPGLKDIKVNKGD-------KVCEPVVFTADPAPEIVLL 1950
            .|..|.| .|.:..     |:|...:|.....:..: ||       :.|.|......|..|    
  Rat   801 CQVSLMLHKGPSRVPPPRGREPASCEGLCGGGVGAH-GDADRDGTLRPCWPARGQGWPEEE---- 860

  Fly  1951 KDGQPVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKNKYGELVTSGWIDVL 2015
             ||:.|  ...:|.:|:.:            |:..|| |:.....:|..::..|:.|::..:.. 
  Rat   861 -DGEDV--RGLLKRRVETR------------LHTEEA-IRQQEVGQLDFRDLLGKKVSTKTVSE- 908

  Fly  2016 AKPEISGLNDTKCLPGDTICFEALVQANPKPKVSWTRGNENLCNHENCEVIADVDADKYRLVFQS 2080
                    :|.|.:|.:.:.|.|.:|...|||   |...|....|                    
  Rat   909 --------DDLKDIPAEQMDFRANLQRQVKPK---TVSEEERKVH-------------------- 942

  Fly  2081 VSPCEDGKYTITATNSEGRAAVDFNLAVLVEKPTFIVQPESQSIHDYRPVSTKVLVHGVPLPTIE 2145
             ||.:                |||. :||.:|.|    |::       ||..||           
  Rat   943 -SPQQ----------------VDFR-SVLAKKGT----PKT-------PVPEKV----------- 967

  Fly  2146 WFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATN-EIGVTKA 2209
                                    ...|..|....|||..|.....:.|..|....| :.|.:..
  Rat   968 ------------------------PPQKAATPDFRSVLGSKKKSPAENGGNTAEVLNVKAGESPT 1008

  Fly  2210 PFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPD 2274
            |               ..||..|...:|:       |:..| .:.||.....||:|::|      
  Rat  1009 P---------------AGNAQPVGALKPI-------GNAKP-AETLKSVGNAKPAETLK------ 1044

  Fly  2275 GLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEA 2339
                 .:.:.:|.::       ..|.|.        |||.|.    ||||.:            |
  Rat  1045 -----PVGNAKPAET-------LKPVGN--------VKPAET----LKPIAN------------A 1073

  Fly  2340 QVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVS 2404
            |.:|.|.|                              |..|||::.                  
  Rat  1074 QPSGSPKP------------------------------IANAQPIET------------------ 1090

  Fly  2405 KVEIVPKESKPVFVAELQDASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPD 2469
                    .|.|..|:..:...:.|   |.::|.|.|            ::....:|:....|..
  Rat  1091 --------QKSVANAKSAETPKLAG---KEELKEVRN------------DVNCKKAHVGATGNEK 1132

  Fly  2470 NSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQ 2534
            ...|                     :||                    ||.|...|:||:..||:
  Rat  1133 RPES---------------------QGS--------------------APVFKEKLQDVHVAEGE 1156

  Fly  2535 ELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGE 2599
            :|:|.....|:|...|.|:.:|.||...:.:::..:|....::|:.|...|.|.|.|:..|..|:
  Rat  1157 KLLLQCQVTSDPPATVTWTLNGKTLKTTKFIILAQEGSLFSVSIEKALPEDRGLYKCVAKNSAGQ 1221

  Fly  2600 DSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPKSEKYSIK 2664
            ...:|...|               .......|.|.|...|..|...|      .|:..:|     
  Rat  1222 AECSCQVTV---------------DDAGTSENTKAPEMKSRRPKSSL------TPVLGTE----- 1260

  Fly  2665 NDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHSRSEPPVFLKKIGDCDIY 2729
                           .|..|.|..||....|                 .:.||..::...|..:.
  Rat  1261 ---------------SDATVKKKPASKTPTK-----------------AAMPPQIIQFPEDQKVR 1293

  Fly  2730 EGMVAKFTACATGYPEPEVEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFN 2794
            .|...:.....||.......|.|..:::..|:...::...:| .:|||....:...|        
  Rat  1294 AGEPVELFGKVTGTQPITCTWMKFRKQIQESENIRVENSESG-SKLTILAARQEHCG-------- 1349

  Fly  2795 PYGDDICHAELFYDSLDSQQKPLEDQYTDFKKYKKSGAPPPLSEGPIISRMTDRGLLLSWNPSVP 2859
                  |:..:..:.|.|:|..:.....|        .|.|.:..|..|.:....|.|||..|..
  Rat  1350 ------CYTLVVENKLSSRQAQVNLTVVD--------KPDPPAGTPCASDIRSSSLTLSWYGSSY 1400

  Fly  2860 LTPRYPITYQIEMMDLPEGDWRTLRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQT 2924
            .......:|.:|:.|..:..|..|.| .||.:.::::|.|.|:|:||||..|.:|.|:||   |.
  Rat  1401 DGGSAVQSYNVEIWDTEDKVWTELAT-CRSTSFNVQDLLPDREYKFRVRAVNVYGTSEPS---QE 1461

  Fly  2925 YRQKLVPDPPKTYTYLPPGTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVKDHN 2989
            .....|.:.|:.                  |||                    |.::|       
  Rat  1462 SELTAVGEKPEE------------------PKD--------------------EVEVS------- 1481

  Fly  2990 TELMWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGE 3054
                               ||                                            
  Rat  1482 -------------------DD-------------------------------------------- 1483

  Fly  3055 ARQRVRLEIAEHPRFLKRPDETFIMARKNGRIEAKLVGIPLPEVHWFKDWKPIVDSSRIKISSYD 3119
                               ||                  ..|||    |::              
  Rat  1484 -------------------DE------------------KEPEV----DYR-------------- 1493

  Fly  3120 PDIYVLSIHDSIIKDGGLYSISARNIAGSISTSVTVHIEENEDQYIYKTYGRHPYVRSKQLRYQD 3184
                                            :|||:.|:                     :..|
  Rat  1494 --------------------------------TVTVNTEQ---------------------KVSD 1505

  Fly  3185 KYDIGDELGRGTQGITYHAVERSSGDNYAAKIM--YGRPELRPFMLNELEMMNTFNHKNLIRPYD 3247
            .|||.:.||.|..|..:..||:.:|..:|.|..  |...| :..:..|:.:||..:|..|::..|
  Rat  1506 VYDIEERLGSGKFGQVFRLVEKRTGKIWAGKFFKAYSAKE-KENIRQEISIMNCLHHPKLVQCVD 1569

  Fly  3248 AYDTDRSVTLIMELAAGGELVRDNLLRRDY-YTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKD 3311
            |::...::.:::|:.:||||. :.::..|: .|||:...|:||...|:|::|:.|:.|:.|..::
  Rat  1570 AFEEKANIVMVLEIVSGGELF-ERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPEN 1633

  Fly  3312 LLISVVGGDIIKVSDFGLSRKI-NRHNLSTLDYGMPEFVSPEVVNKEGVNFSHDMWTVGLITYVL 3375
            ::.....|..||:.||||:|:: |..:|..| :|.||||:|||:|.|.:.::.|||::|:|.|:|
  Rat  1634 IMCVNKTGTRIKLIDFGLARRLENAGSLKVL-FGTPEFVAPEVINYEPIGYATDMWSIGVICYIL 1697

  Fly  3376 LGGHNPFLGIDDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWF 3440
            :.|.:||:|.:|.|||..:....|||.||.:..||:|.:||||.||....:.|:|....|:||| 
  Rat  1698 VSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISEDAKDFISNLLKKDMKNRLDCTQCLQHPW- 1761

  Fly  3441 FMLDRPVYDHDYQIGTDRLRNYYDHFRDWYANASCKNYFRRRRLSGCFQHPSKMVYPPGHVYTPE 3505
            .|.|....:.. ::..||:                |.|..||:    :|.....|...|      
  Rat  1762 LMKDTKNMEAK-KLSKDRM----------------KKYMARRK----WQKTGNAVRAIG------ 1799

  Fly  3506 NTPEPLPEPRIRAKREEVVSKYLHPDYELGLIQSESHYQYGPDTYLLQLRDVNFPVRLREYMKVA 3570
                       |.....::|         ||...:|                             
  Rat  1800 -----------RLSSMAMIS---------GLSGRKS----------------------------- 1815

  Fly  3571 HRRSPSFALNDSVDWSLPVIRERRRFTDIMDEEIDDERTRSRISMYAANESYSIRRLRTELGPRL 3635
            ...||:..:|                    .|:::.|...|:                       
  Rat  1816 STGSPTSPIN--------------------AEKLESEEDVSQ----------------------- 1837

  Fly  3636 DEYTEADAMIETQREGYP---PFFREKPQTIAITENQPSHIHCFAVGDPKPCVQWFKNDMVLTES 3697
                   |.:|...|..|   |:|.:..:.:.:.|...:...|...|.|.|.|.|||:|..:.||
  Rat  1838 -------AFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRES 1895

  Fly  3698 KRIKISVDEDGRSILRFEPALHFDVGVYKVVARNKVGQTVARCRIVVATLPD 3749
            :..:|..||||...|........|...|...|.|.:|:......::|.|:.:
  Rat  1896 RHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEE 1947

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Not5 <477..>652 CDD:444384
Ig 1017..1108 CDD:472250 23/91 (25%)
Ig strand B 1034..1038 CDD:409353 2/3 (67%)
Ig strand C 1046..1050 CDD:409353 2/3 (67%)
Ig strand E 1074..1078 CDD:409353 1/3 (33%)
Ig strand F 1088..1093 CDD:409353 2/4 (50%)
Ig strand G 1101..1104 CDD:409353 1/2 (50%)
I-set 1123..1212 CDD:400151 29/88 (33%)
Ig strand B 1140..1144 CDD:409353 2/3 (67%)
Ig strand C 1153..1157 CDD:409353 1/3 (33%)
Ig strand E 1182..1186 CDD:409353 1/3 (33%)
Ig strand F 1196..1201 CDD:409353 3/4 (75%)
Ig strand G 1209..1212 CDD:409353 0/2 (0%)
Ig <1236..1299 CDD:472250 12/62 (19%)
Ig strand C 1238..1242 CDD:409353 0/3 (0%)
Ig strand E 1259..1269 CDD:409353 2/9 (22%)
Ig strand F 1279..1284 CDD:409353 0/4 (0%)
Ig strand G 1292..1295 CDD:409353 1/2 (50%)
I-set 1313..1403 CDD:400151 15/100 (15%)
Ig strand B 1330..1334 CDD:409353 0/3 (0%)
Ig strand C 1343..1347 CDD:409353 1/3 (33%)
Ig strand E 1369..1373 CDD:409353 1/3 (33%)
Ig strand F 1383..1388 CDD:409353 0/4 (0%)
Ig strand G 1396..1399 CDD:409353 0/2 (0%)
Ig_3 1406..1487 CDD:464046 8/80 (10%)
I-set 1499..1595 CDD:400151 20/101 (20%)
Ig strand B 1522..1526 CDD:409353 1/3 (33%)
Ig strand C 1535..1539 CDD:409353 0/3 (0%)
Ig strand E 1561..1565 CDD:409353 1/3 (33%)
Ig strand F 1575..1580 CDD:409353 1/4 (25%)
Ig strand G 1588..1591 CDD:409353 0/2 (0%)
Ig 1599..1690 CDD:472250 25/90 (28%)
Ig strand B 1617..1621 CDD:409353 2/3 (67%)
Ig strand C 1630..1634 CDD:409353 0/3 (0%)
Ig strand E 1656..1660 CDD:409353 1/3 (33%)
Ig strand F 1670..1675 CDD:409353 3/4 (75%)
Ig strand G 1683..1686 CDD:409353 0/2 (0%)
I-set 1694..1786 CDD:400151 28/94 (30%)
Ig strand B 1711..1715 CDD:409353 1/3 (33%)
Ig strand C 1724..1728 CDD:409353 0/3 (0%)
Ig strand E 1752..1756 CDD:409353 1/3 (33%)
Ig strand F 1766..1771 CDD:409353 2/4 (50%)
Ig strand G 1779..1782 CDD:409353 0/2 (0%)
Ig <1836..1903 CDD:472250 20/67 (30%)
Ig strand C 1846..1850 CDD:409353 0/3 (0%)
Ig strand E 1871..1875 CDD:409353 1/3 (33%)
Ig strand F 1885..1890 CDD:409353 1/4 (25%)
Ig 1922..2005 CDD:472250 16/89 (18%)
Ig strand B 1933..1937 CDD:409353 1/3 (33%)
Ig strand C 1946..1950 CDD:409353 1/3 (33%)
Ig strand E 1971..1984 CDD:409353 1/12 (8%)
Ig strand F 1994..1999 CDD:409353 1/4 (25%)
Ig 2018..2108 CDD:472250 17/89 (19%)
Ig strand B 2034..2038 CDD:409353 1/3 (33%)
Ig strand C 2047..2051 CDD:409353 1/3 (33%)
Ig strand E 2074..2078 CDD:409353 0/3 (0%)
Ig strand F 2088..2093 CDD:409353 0/4 (0%)
Ig strand G 2101..2104 CDD:409353 1/2 (50%)
Ig 2113..2214 CDD:472250 17/101 (17%)
Ig strand B 2130..2134 CDD:409353 1/3 (33%)
Ig strand C 2143..2147 CDD:409353 0/3 (0%)
Ig strand E 2176..2185 CDD:409353 4/8 (50%)
Ig strand F 2195..2200 CDD:409353 1/4 (25%)
I-set 2220..2302 CDD:400151 14/81 (17%)
Ig strand B 2238..2242 CDD:409353 0/3 (0%)
Ig strand C 2251..2255 CDD:409353 0/3 (0%)
Ig strand E 2277..2281 CDD:409353 0/3 (0%)
Ig strand F 2291..2296 CDD:409353 0/4 (0%)
Ig strand G 2304..2307 CDD:409353 0/2 (0%)
I-set 2318..2408 CDD:400151 13/89 (15%)
Ig strand B 2335..2339 CDD:409353 0/3 (0%)
Ig strand C 2348..2352 CDD:409353 0/3 (0%)
Ig strand E 2374..2378 CDD:409353 0/3 (0%)
Ig strand F 2388..2393 CDD:409353 0/4 (0%)
Ig 2415..2506 CDD:472250 12/90 (13%)
Ig strand B 2432..2436 CDD:409353 1/3 (33%)
Ig strand C 2445..2449 CDD:409353 0/3 (0%)
Ig strand E 2472..2476 CDD:409353 1/3 (33%)
Ig strand F 2486..2491 CDD:409353 0/4 (0%)
Ig strand G 2499..2502 CDD:409353 0/2 (0%)
I-set 2519..2608 CDD:400151 26/88 (30%)
Ig strand B 2536..2540 CDD:409353 2/3 (67%)
Ig strand C 2549..2553 CDD:409353 1/3 (33%)
Ig strand E 2574..2578 CDD:409353 0/3 (0%)
Ig strand F 2588..2593 CDD:409353 2/4 (50%)
I-set 2615..2696 CDD:400151 13/80 (16%)
Ig strand B 2632..2636 CDD:409353 1/3 (33%)
Ig strand C 2645..2649 CDD:409353 1/3 (33%)
Ig strand E 2670..2674 CDD:409353 0/3 (0%)
Ig strand F 2684..2689 CDD:409353 2/4 (50%)
Ig strand G 2697..2700 CDD:409353 0/2 (0%)
I-set 2717..2805 CDD:400151 14/87 (16%)
Ig strand B 2734..2738 CDD:409353 0/3 (0%)
Ig strand C 2747..2751 CDD:409353 0/3 (0%)
Ig strand E 2773..2777 CDD:409353 1/3 (33%)
Ig strand F 2787..2792 CDD:409353 0/4 (0%)
Ig strand G 2800..2803 CDD:409353 1/2 (50%)
FN3 2834..2925 CDD:238020 30/90 (33%)
Ig <2996..3063 CDD:472250 2/66 (3%)
Ig strand C 3003..3007 CDD:409353 0/3 (0%)
Ig strand E 3029..3033 CDD:409353 0/3 (0%)
Ig strand F 3043..3048 CDD:409353 0/4 (0%)
Ig strand G 3056..3059 CDD:409353 0/2 (0%)
Ig 3067..3157 CDD:472250 9/89 (10%)
Ig strand B 3085..3088 CDD:409353 0/2 (0%)
Ig strand C 3097..3101 CDD:409353 2/3 (67%)
Ig strand E 3123..3127 CDD:409353 0/3 (0%)
Ig strand F 3137..3142 CDD:409353 0/4 (0%)
Ig strand G 3150..3153 CDD:409353 0/2 (0%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 95/261 (36%)
Ig 3654..3744 CDD:472250 25/89 (28%)
Ig strand B 3671..3675 CDD:409353 0/3 (0%)
Ig strand C 3684..3688 CDD:409353 1/3 (33%)
Ig strand E 3710..3714 CDD:409353 1/3 (33%)
Ig strand F 3724..3729 CDD:409353 1/4 (25%)
Ig strand G 3737..3740 CDD:409353 0/2 (0%)
FN3 3748..3840 CDD:238020 0/2 (0%)
STKc_Unc-89_rpt2 3893..4151 CDD:271014
MylkNP_001099344.2 I-set 42..132 CDD:400151 23/91 (25%)
Ig strand B 59..63 CDD:409353 2/3 (67%)
Ig strand C 72..76 CDD:409353 2/3 (67%)
Ig strand E 93..102 CDD:409353 1/8 (13%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
I-set 165..254 CDD:400151 30/108 (28%)
Ig strand B 182..186 CDD:409405 2/3 (67%)
Ig strand C 195..199 CDD:409405 1/3 (33%)
Ig strand E 220..224 CDD:409405 1/3 (33%)
Ig strand F 234..239 CDD:409405 3/4 (75%)
Ig strand G 247..250 CDD:409405 0/2 (0%)
23ISL 255..408 CDD:435470 39/268 (15%)
I-set 410..500 CDD:400151 20/101 (20%)
Ig strand B 427..431 CDD:409405 1/3 (33%)
Ig strand C 440..444 CDD:409405 0/3 (0%)
Ig strand E 466..470 CDD:409405 1/3 (33%)
Ig strand F 480..485 CDD:409405 1/4 (25%)
Ig strand G 493..496 CDD:409405 0/2 (0%)
IgI_4_MYLK-like 509..596 CDD:409568 26/91 (29%)
Ig strand A 509..512 CDD:409568 2/2 (100%)
Ig strand A' 518..521 CDD:409568 0/2 (0%)
Ig strand B 526..534 CDD:409568 2/8 (25%)
Ig strand C 540..544 CDD:409568 0/3 (0%)
Ig strand C' 547..550 CDD:409568 1/2 (50%)
Ig strand D 554..558 CDD:409568 1/7 (14%)
Ig strand E 562..567 CDD:409568 1/4 (25%)
Ig strand F 575..583 CDD:409568 4/7 (57%)
Ig strand G 586..596 CDD:409568 2/9 (22%)
Ig 619..708 CDD:472250 30/114 (26%)
Ig strand B 636..640 CDD:409353 1/3 (33%)
Ig strand C 649..653 CDD:409353 0/3 (0%)
Ig strand E 674..678 CDD:409353 1/3 (33%)
Ig strand F 688..693 CDD:409353 2/4 (50%)
Ig strand G 701..704 CDD:409353 0/2 (0%)
I-set 717..805 CDD:400151 24/89 (27%)
Ig strand B 734..738 CDD:409405 1/3 (33%)
Ig strand C 747..751 CDD:409405 0/3 (0%)
Ig strand E 773..777 CDD:409405 1/3 (33%)
Ig strand F 787..792 CDD:409405 1/4 (25%)
Ig strand G 800..803 CDD:409405 1/2 (50%)
I-set 1141..1230 CDD:400151 26/88 (30%)
Ig strand B 1158..1162 CDD:409353 2/3 (67%)
Ig strand C 1171..1175 CDD:409353 1/3 (33%)
Ig strand E 1196..1200 CDD:409353 0/3 (0%)
Ig strand F 1210..1215 CDD:409353 2/4 (50%)
Ig strand G 1223..1226 CDD:409353 0/2 (0%)
IgI_8_hMLCK_like 1280..1378 CDD:409419 21/120 (18%)
Ig strand A 1280..1284 CDD:409419 2/3 (67%)
Ig strand A' 1289..1293 CDD:409419 1/3 (33%)
Ig strand B 1297..1306 CDD:409419 0/8 (0%)
Ig strand C 1310..1316 CDD:409419 1/5 (20%)
Ig strand C' 1319..1321 CDD:409419 0/1 (0%)
Ig strand D 1327..1332 CDD:409419 0/4 (0%)
Ig strand E 1336..1341 CDD:409419 2/4 (50%)
Ig strand F 1349..1357 CDD:409419 2/21 (10%)
Ig strand G 1360..1370 CDD:409419 2/9 (22%)
FN3 1374..1465 CDD:238020 31/94 (33%)
STKc_MLCK1 1504..1762 CDD:271093 96/261 (37%)
IgI_telokin-like 1855..1942 CDD:409565 23/86 (27%)
Ig strand A 1855..1858 CDD:409565 0/2 (0%)
Ig strand A' 1860..1863 CDD:409565 0/2 (0%)
Ig strand B 1867..1876 CDD:409565 1/8 (13%)
Ig strand C 1881..1887 CDD:409565 3/5 (60%)
Ig strand C' 1890..1892 CDD:409565 0/1 (0%)
Ig strand D 1898..1903 CDD:409565 1/4 (25%)
Ig strand E 1906..1914 CDD:409565 2/7 (29%)
Ig strand F 1922..1929 CDD:409565 2/6 (33%)
Ig strand G 1932..1942 CDD:409565 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.