DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and zormin

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_001261317.1 Gene:zormin / 2769001 FlyBaseID:FBgn0052311 Length:3664 Species:Drosophila melanogaster


Alignment Length:3570 Identity:658/3570 - (18%)
Similarity:1146/3570 - (32%) Gaps:1215/3570 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ADIVFVSRDYQAQ--SLATDEISVSRGDLVELISSKA----------SEKSRCFVRMFDSGDSPK 57
            ||.:..|:...::  :...|.:::...|::.|:..:.          .:.::||.:|.....:.:
  Fly   169 ADKLLASKRISSELVNAMADTLNIIWQDILNLLQDRQHLLILCTQFHDKMTQCFRKMDQLELACE 233

  Fly    58 EGWVPIDI------------LEFNPTMSSSNGKESGD---AEFRKLTILRELVETEEEFSRD--- 104
            |...|.|:            |..:.........:.|:   |:..:|..|..|....|...||   
  Fly   234 ETLHPPDVPRVQEFLNRFKQLRIDMLTGVMAALKDGNELLAQLEELEKLETLDTRPEHIKRDATR 298

  Fly   105 LLHVVEKYIKGIDKPVVPRSVRDNKDIIFCNFLQIAEFHNNVLKEGLKCYSNQPNMVAKTFLRLE 169
            .:|.|:::::         ::.|.:     |.|::|.....:..|  :|                
  Fly   299 AVHQVQQWLE---------ALHDRR-----NSLELAWQTRKIQME--QC---------------- 331

  Fly   170 RDFDKHVVYCQNEPLAQDYLGSS-PDAKKYFQELSKQLGDDKSL--AEHLKLPIQRINDYQLLFK 231
                          ||...||.. .|.:...|:...:|....||  .||      ..|:....::
  Fly   332 --------------LALALLGRELVDLEAALQQARMELNTMYSLGECEH------TANEMLTKYR 376

  Fly   232 DFIKYSLSLKENVKDLERALELMLSVP--------SRAYDNRFLSSIEGCRGNIYKLGRLLLHAW 288
            ::.:.:|.|::....:.||.|.:.|..        :|||     :.:.||..::           
  Fly   377 EWKQQALLLRDRALKITRAKEKVQSAGHFTEEDACARAY-----AVLSGCTEHL----------- 425

  Fly   289 CNVVDKEGKAHDRYCFLFKSRILVTKVRKISENRSVFILQNIVKLPLCNIELKADEKQIHLSLKA 353
             ::||:      |..:|.:||....|.     ..:|.:|:.:      .:||        .|:|.
  Fly   426 -DLVDQ------REHWLHQSREFFAKA-----EHTVSVLEKL------ELEL--------TSVKL 464

  Fly   354 PEANSFLPIDIKPHGPEAHLTWFNEISSHI----------------------------------- 383
            |           ||.||:: ..|:::...:                                   
  Fly   465 P-----------PHSPESY-AMFSKVDRDVRNFTEEPLRLGYGILDEVGRTQPETQGVKRVLDEL 517

  Fly   384 -NQDVTLQ----EHNADDLKVD--ASQIASESELILHLPQRAEAHDPNLSVRPSDVAENYFLSKE 441
             |:.|.:|    ..:.|..||.  .|:..:....:|...:.:..|....||   |:..|  |.:.
  Fly   518 ENRKVYIQGICANSSEDQQKVQRALSEFLNHHNELLAWLRASGQHQLQQSV---DMGGN--LQQA 577

  Fly   442 TKERLQHEQ--------QELLKLEQEAIELYKKQ---QSSKSVSSKTES-----VEITSSQVKS- 489
            .:..|||.:        .||:.|..|:|:::.:.   |....|.||.||     :|:....:|. 
  Fly   578 KQFLLQHHELMQDLEIKGELINLLLESIKVHLESLSPQERYDVDSKAESLHKHWIELKDLVLKRV 642

  Fly   490 ----------------SSEV----RKVVSPPPPPQAQVKEVTPVKVVSS----PPPPKEITPAKV 530
                            ||::    |::...|...:.|..:.|...:.|:    ....:.....|:
  Fly   643 DYVSLLIDFFELANELSSQLDNLQRQLQQTPDEHKLQFLQATWTGIASTFGELKSRGQRFINLKI 707

  Fly   531 ATPPPQPQVVTSPVKEVAPPPQPRAVASPAKEVTPSQSEPVKAPSPIKEVRKEVPPSASHSKEVE 595
            ..|..:.:.....|:|.......|.|     :||.|              .:....|.:..:|||
  Fly   708 VDPYLETKSSAQAVQETLNDFSKRQV-----DVTSS--------------LENWTTSIAEKREVE 753

  Fly   596 ALVATEIRESLTETRSTVVESGQSSEIREEIVVTEESSLEGKQVVALEREPSPCSIPKI-----Q 655
            .|    :.:.:::...||.:|.|..  .:...|....|::.||::...||.....|..|     :
  Fly   754 YL----LEKVMSDNEETVAKSTQVD--TQLYPVFTSQSVDSKQLLISTREKLTNVIQDIERAQDE 812

  Fly   656 VYRPVECENPVVTKHKP----IE-----------------------LKDIVGYSESL----RDGD 689
            :.:.::....:.||.:|    ||                       ::.::.:.|::    |:.|
  Fly   813 IQQRIQTTLGIQTKDQPSLAKIEQVINNLRMLKAKLDGIKYDYRTLVESVIQFLENIVQLRREID 877

  Fly   690 TAPAGGSPGRQQGYSANITDHASLTIWNNRLANIAGDRSGANQHLQQSGPPPPPIPPNFTRMPGF 754
            ...|     |||...|:..|.           :||......:|.:.:                  
  Fly   878 DYFA-----RQQKEPASGADR-----------SIAEHEKFRDQCMDK------------------ 908

  Fly   755 FQPLPLIAYETTIEILIVKARPPSPPPPPPPTIKRVL-------VHTES--------LE--QKTQ 802
            |:.|     .|..|:||.:.|...||........|:|       :|.||        ||  :|.:
  Fly   909 FRSL-----ITQSELLIDRVRVLEPPGAREIDTDRILKLLENLRLHFESNSSARMSTLERLEKIE 968

  Fly   803 NFFEGIYDAASSDTSLRNAKQKI---------------------------------RSIKST--- 831
            .|...:.|.   |.||.:..|::                                 |.:|||   
  Fly   969 QFRSDLEDI---DRSLDSVSQQLHEINNQSVDSLAAAKTTSLAFEYFERTIECSMPRQLKSTRHQ 1030

  Fly   832 ----------------------------VLKSKDSTNYAQDTVQKAKARDFLHIFTPPVKKRPIY 868
                                        .:.:.:|..|.:|.::|...:  ...|...||::  .
  Fly  1031 RRWGQTAHTIELLEKRIEKFTESTSQQLFITNPESERYVKDELRKLNEK--WQSFKDQVKQK--R 1091

  Fly   869 EIVEEPVNIFELEGDYTESIADDFREPS-------------ADFEARGQSVGGMDDYYSGYSRAS 920
            :.:.:..:.||:    .|.|..::||.|             .|....|..|..:::|.:....|.
  Fly  1092 KSLNQATDFFEV----VEKIDAEYREISYFYTSVSNKVPYLRDSVEAGNLVNDIENYVTSREAAL 1152

  Fly   921 TRRYETKTR---DYDRGTS-YDSTVERSQYGI-------------------SSRRDRSSVDKVEA 962
            ..:.::.::   |.::.:| |:..:...|..|                   ..:|:|.:.|:.| 
  Fly  1153 RSKLDSASQCAHDMNKVSSLYNDVMNIFQSFIKLKMDINVVQERLKQEQRQKEQRERDARDQAE- 1216

  Fly   963 RSSLLATGRTESRAASRAESRAES--------RASYSVAESRAGIRSSSRLQEDRPLRSVDKPVV 1019
            |...:.....:.|.....:||.|:        :|...:|.....:|..:..:|:..|:::.:...
  Fly  1217 REKAIKEAEAKERLHREEQSRLENQRQQAAIEQAQRELAARELALREQAVREEEARLQAIREQAT 1281

  Fly  1020 VKMLKSVQVEPGETAHF----EIQFKDQPGLVTWLKDNKPLEDRLADRITQTAAPMNSYRLDIKN 1080
            .:.|...|....|....    :|..:::...:..::|.   |.|:.....:.....|..|    :
  Fly  1282 REQLAREQAAREEELRIQSLRDIARREEEVRLQNIRDE---ETRIRREEEERIRRENESR----S 1339

  Fly  1081 CSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHDETKTNTE-------------------PAFL 1126
            ..|.:|   .|:.:..:...|:..|:        |:.:..||                   |.|.
  Fly  1340 KREEEA---RIQREEITRLQTLRDQV--------DQQRIVTENIRKDIQVNSIFTELRYASPLFT 1393

  Fly  1127 VSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIADVQK 1191
            ..||||...|...|.|..::.|.|:|.|:::||...| :||...:...||   |...|||.:...
  Fly  1394 RPLKDAVSREGDRFVFECEVTGTPEPAVEWFKDGISI-QTNSDYKTTFDK---GICRLVIEETFA 1454

  Fly  1192 TDAGTYSCKATNKHGEANCEAIATTVEDKNPFGALSGQILP------------------------ 1232
            .|:..:||:|:|..|  .|:..||....:|   |...|::|                        
  Fly  1455 ADSARFSCRASNLVG--TCDTNATLSVREN---AAEVQLVPPRILRFLQSGKATEGSSFQFACVV 1514

  Fly  1233 AG-EKPVFQWKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAE 1296
            || ..|..||.:|.:..|....:.:.:...|.:|.  |:.|..||..:|||.|....|...|||.
  Fly  1515 AGVPLPTVQWFKNDKCIDDSPDYVISYNNGEATLK--FEEVFLEDDAVYTCSASNPAGIEHCSAS 1577

  Fly  1297 LSVQGAIQTLNREP-EKPTLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDDRHK 1360
            |.|:..      || |.|:..:....|.|.:|....||....|.|:|.|.|.|:|:..|..| .|
  Fly  1578 LIVEPL------EPTELPSFKVPLSNAMARVGQKIKLEAIVGGIPRPEVYWLHNGKPFQPRD-SK 1635

  Fly  1361 FMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLVVKAPPKIKKITDITCSAGETIKM 1425
            :.|   ..::|:|......|||.|.:.|.|..|:..:|.|::||.                    
  Fly  1636 YEY---GRVTLIIPQAYPNDAGSYVLSAKNLAGEAYTSCNVIVKG-------------------- 1677

  Fly  1426 EIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKV-VVEVKEIKLSQAGNYSIKATNDL 1489
                        ::.|...|....|:::....::...|:.| :.|.|.::|              
  Fly  1678 ------------RLPNETSDSEMASDIEPIKPAVHLPLKDVSIFEGKPVRL-------------- 1716

  Fly  1490 SQTSEYWSCTVKSKPVIVKNFESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTV 1554
                   .|.:..:                            ||.::.|||:|..:| ..:...:
  Fly  1717 -------DCVIVGQ----------------------------PEPEVIWYHNERPVK-ESADVQL 1745

  Fly  1555 SSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAPEFTHKLKNITVAEGDSNVEL 1619
            ...|:..:|.|....:.|||.|.|.|.|..|.|:||.:|  |..|                    
  Fly  1746 LFQGDRCSLIIQEVYQEDAGHYKVVAINSAGEASSSCEL--KVTP-------------------- 1788

  Fly  1620 VVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQV--ATNMQGNYTCKIMNDYGKL 1682
                                                    :||.  ||..|.             
  Fly  1789 ----------------------------------------LNQAEPATRAQA------------- 1800

  Fly  1683 EDNCVVTVNCKPKVKRGLKNVEVQEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQ 1747
             :...:..:.:||.:|.|.:|...||:...|||:...:.....:||....|:..|.||....|::
  Fly  1801 -ERQSLPKDSQPKFERLLSDVLADEGEQVVLEVQASGDQPLTAQWFLTNKELQLDQRITTQSDSE 1864

  Fly  1748 RIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAVLTSEALSLEQTVTKTLIATTEEPEEG 1812
             :..:.|.||....:|.|.|.:|.||..|:  :.|...::.....:.|.  .::..::.|..|..
  Fly  1865 -LGVFKLILNNVSGDDKGVYTVKVTNPAGD--AKCFSHLIVKSVNAPEN--RRSSQSSVEIIERH 1924

  Fly  1813 AVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPEAIWYHDGKPITPDKHTAITVDGDHYKLEVQS 1877
            ..||...:...:|...:.| :|:|.|..|.|.|:..|:.:.:|: ...:..::..|:...|.:|.
  Fly  1925 QCPEFKELFSDKQGEIDEV-IKFECIVKGKPTPKVHWFFNDQPV-HGHNFLVSTSGERQVLTIQK 1987

  Fly  1878 LDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYRKPILTQGPGLKDIKVNKGDKVCEPVVFTAD 1942
            |.....|:...|.:|:.|:.:....|::            :|.||                    
  Fly  1988 LTHDAVGKISCVAENEAGKATCVAFLNI------------RGSGL-------------------- 2020

  Fly  1943 PAPEIVLLKDGQPVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKNKYGELV 2007
            ||.     .|.|.|.:.:|.                            :|.|..:|         
  Fly  2021 PAS-----SDVQTVSQEHNT----------------------------ESSRVTIK--------- 2043

  Fly  2008 TSGWIDVLAKPEISGLNDTKCLPGDTICFEALVQANPKPKVSWTRGNENLCNHENCEVIADVDAD 2072
                                                                             
  Fly  2044 ----------------------------------------------------------------- 2043

  Fly  2073 KYRLVFQSVSPCEDGKYTITATNSE---GRAAVDFNLAVLVEKPTFIVQPESQSIHDYRPVSTKV 2134
              :..|.:.|..:...|...|..:|   ..|.:|.:|..|.::     :||....|.|:      
  Fly  2044 --KQTFTTTSTSQVNSYEGNAPQTEVHHSSAHIDQSLKQLGQQ-----RPEIVESHHYQ------ 2095

  Fly  2135 LVHGVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCV 2199
                                          :|:..::....|.|.:|...|:|...|...|    
  Fly  2096 ------------------------------ELHKSKEMSSPTVQQKSFSFIQSSGANGQSA---- 2126

  Fly  2200 ATNEIGVTKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPS 2264
                :.:..:|.:|.. .:||.|...|...: |.||..:.:|...||.|.|.::..|:|.::...
  Fly  2127 ----VAIPDSPTRLRR-EIAPRFTTPLSGKI-VDQGADVSMEAIYDGFPSPEIKVEKNGGQLFED 2185

  Fly  2265 ESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTV 2329
            ...:|| |....|.:|:......|:|.|.:..||..|:..:...:.||.....|.|.:.:.:|..
  Fly  2186 AHTRIS-NKCNRVTIELKQVGVGDAGRYAVTASNTVGQSTSTADLVVKKTIFPPVFGRRLQAQVS 2249

  Fly  2330 VVGEPLKLEAQVTGFPAPEVKWYKDGMLLRPS--PEINFINSPNGQIGLIIDAAQPLDAGVYKCL 2392
            ..||.|.:|.:|||.|.|.|.|.||...|:.:  .|...:...| ...|||:.||..|:|.|...
  Fly  2250 KKGEKLTMEVEVTGLPEPTVTWLKDDKPLKDAGISEHRLLAQGN-SYRLIIEKAQTTDSGKYMVR 2313

  Fly  2393 IANKGGEIEGVSKVEIVPKESKPVFVAELQDASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKP 2457
            ..|.|||.:.::...|:  |..|..:.|:          ||..:...|...|       ..|.|.
  Fly  2314 ATNAGGEAKSIADCAIL--EPSPERLQEV----------VKTIVYETGPVAP-------ASEFKT 2359

  Fly  2458 DASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNP-EGSTASKAKLYVAPKADETATEEAPQF 2521
            :..  ..::|.:|..|....:|        ||.:.|. .|.:.||.      ..:...|.||...
  Fly  2360 EVQ--KQIQNSENQQSYQNSQT--------EVTSANDLHGLSESKV------ITEHRCTTEATMR 2408

  Fly  2522 VSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADS 2586
            :         |.:...|..|.::. .|:...:.|.:|:|.|...:                :.|.
  Fly  2409 L---------EHKSNYLDLPELTT-RPKTPTTNDTITITTNTATV----------------SMDQ 2447

  Fly  2587 GNYTCLLANPLGEDSSACNANVRKVYKP-------PVFTQKISDQQQVFGNNAKIPVTVSGVPYP 2644
            .:    |..|  ..::....|..||..|       ||.......|||      :.|.|::...|.
  Fly  2448 PD----LTQP--TITNTTTTNTTKVPPPVPPKPCTPVVATTFGQQQQ------QPPQTLTSTRYE 2500

  Fly  2645 DLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYK---CIASNREGKDITQGRLDIVN 2706
            ..|    .|....|..:......|...:|    ::.:...:|   .:....:.:.:.: .|..:|
  Fly  2501 QSE----HKSTTSSSSFDYFKKIDEETII----QRPNPLTFKPLDTVVRQPQAQSLAE-ELRSLN 2556

  Fly  2707 EI----------KKHSRSEP--PVFLKKIGDCDIYEGMVAKFTACATGYPEPEVEWFKNDQKLFP 2759
            .|          .|..||||  |:..:||   .|...:..|......|.|            :||
  Fly  2557 LIPGDAPEFCYSPKTERSEPKIPLITEKI---KILSEVQPKEPPPQGGVP------------VFP 2606

  Fly  2760 SDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYGDDICHAELFYDSLDSQQKPLEDQYTDF 2824
                    .|.||..:..::.|..:|     ::  .||..|....... :..:||.|        
  Fly  2607 --------PPLGLQTVQHESTTTKEV-----KV--EYGQPIVRPAAVL-ATPAQQNP-------- 2647

  Fly  2825 KKYKKSGAPPPLSEGPIISRMTDRGLLLSWNP--------------------------------- 2856
                :|.:|.|.:||..:||:        |.|                                 
  Fly  2648 ----RSPSPKPSAEGVAMSRL--------WTPTGVTGYTSDVEQKSEKTVISKLATPTPTKELNA 2700

  Fly  2857 ---------SVPLTPRYPITYQIEMMDLPEGDWRTLRTGVRSCACDIRNLEPFRDYRFRVRVENK 2912
                     |:|.|.. |:|:.:.:         .|..|.....|....:|..|.......:|.|
  Fly  2701 PFLVNQIAKSIPPTTA-PVTHLVNV---------ELEPGTPPEICFAPKVEETRRRSLVETMEQK 2755

  Fly  2913 F------GVSDPSPY-----TQTYRQKLVPDPPKTYTYLPPGTDFRPETSP----YFPKDFDIER 2962
            .      |.|...|:     |......:.|.|....||.||     |...|    .:..|::.:|
  Fly  2756 LEQNLIQGPSKVLPHSVPTLTPNTAAPVQPKPLGNTTYRPP-----PPVLPTRLGVYESDYESDR 2815

  Fly  2963 PPHDGLAQAPQFLLREQDISYGVKDHNTELMWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNG 3027
            ..:.|         .|.|:..|::             .:|::|..  :...:|.|     ||.:.
  Fly  2816 YKYSG---------SESDVEPGIR-------------KQPQLTTM--ETSFKSSG-----YTADT 2851

  Fly  3028 QATLFINKMLDRDVGWYEAVATNEHGEARQRVRLEIAEHPRFLKRPDETFIMARKNGRIEAKLVG 3092
            :......|   .:..:||..:::..|.|.|   |: .:.|:....|........|          
  Fly  2852 EEHSSYRK---SESSFYETKSSSTMGGAPQ---LQ-TQFPKLQPEPPAPIYFTAK---------- 2899

  Fly  3093 IPLPEVHWFKDWKPIVDSSRIKISSYDPDIYVLSIHDSIIKDGGLYSISARNIAGSISTS 3152
             |.|:|      .|.|..|:..:||.:...|..:       ...:.|..:.|:..|.|:|
  Fly  2900 -PQPQV------PPQVPPSQSNVSSQEAKGYKYT-------SSSMTSNYSHNMQSSSSSS 2945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091 31/183 (17%)
PH_unc89 275..388 CDD:270134 20/148 (14%)
Not5 <477..>652 CDD:444384 35/204 (17%)
Ig 1017..1108 CDD:472250 14/94 (15%)
Ig strand B 1034..1038 CDD:409353 0/7 (0%)
Ig strand C 1046..1050 CDD:409353 0/3 (0%)
Ig strand E 1074..1078 CDD:409353 1/3 (33%)
Ig strand F 1088..1093 CDD:409353 1/4 (25%)
Ig strand G 1101..1104 CDD:409353 1/2 (50%)
I-set 1123..1212 CDD:400151 31/88 (35%)
Ig strand B 1140..1144 CDD:409353 2/3 (67%)
Ig strand C 1153..1157 CDD:409353 1/3 (33%)
Ig strand E 1182..1186 CDD:409353 1/3 (33%)
Ig strand F 1196..1201 CDD:409353 2/4 (50%)
Ig strand G 1209..1212 CDD:409353 1/2 (50%)
Ig <1236..1299 CDD:472250 20/62 (32%)
Ig strand C 1238..1242 CDD:409353 1/3 (33%)
Ig strand E 1259..1269 CDD:409353 2/9 (22%)
Ig strand F 1279..1284 CDD:409353 3/4 (75%)
Ig strand G 1292..1295 CDD:409353 1/2 (50%)
I-set 1313..1403 CDD:400151 28/89 (31%)
Ig strand B 1330..1334 CDD:409353 1/3 (33%)
Ig strand C 1343..1347 CDD:409353 1/3 (33%)
Ig strand E 1369..1373 CDD:409353 1/3 (33%)
Ig strand F 1383..1388 CDD:409353 1/4 (25%)
Ig strand G 1396..1399 CDD:409353 0/2 (0%)
Ig_3 1406..1487 CDD:464046 8/81 (10%)
I-set 1499..1595 CDD:400151 22/95 (23%)
Ig strand B 1522..1526 CDD:409353 0/3 (0%)
Ig strand C 1535..1539 CDD:409353 0/3 (0%)
Ig strand E 1561..1565 CDD:409353 1/3 (33%)
Ig strand F 1575..1580 CDD:409353 2/4 (50%)
Ig strand G 1588..1591 CDD:409353 1/2 (50%)
Ig 1599..1690 CDD:472250 6/92 (7%)
Ig strand B 1617..1621 CDD:409353 0/3 (0%)
Ig strand C 1630..1634 CDD:409353 0/3 (0%)
Ig strand E 1656..1660 CDD:409353 0/3 (0%)
Ig strand F 1670..1675 CDD:409353 0/4 (0%)
Ig strand G 1683..1686 CDD:409353 0/2 (0%)
I-set 1694..1786 CDD:400151 28/91 (31%)
Ig strand B 1711..1715 CDD:409353 1/3 (33%)
Ig strand C 1724..1728 CDD:409353 0/3 (0%)
Ig strand E 1752..1756 CDD:409353 1/3 (33%)
Ig strand F 1766..1771 CDD:409353 1/4 (25%)
Ig strand G 1779..1782 CDD:409353 0/2 (0%)
Ig <1836..1903 CDD:472250 15/66 (23%)
Ig strand C 1846..1850 CDD:409353 0/3 (0%)
Ig strand E 1871..1875 CDD:409353 1/3 (33%)
Ig strand F 1885..1890 CDD:409353 0/4 (0%)
Ig 1922..2005 CDD:472250 10/82 (12%)
Ig strand B 1933..1937 CDD:409353 0/3 (0%)
Ig strand C 1946..1950 CDD:409353 0/3 (0%)
Ig strand E 1971..1984 CDD:409353 0/12 (0%)
Ig strand F 1994..1999 CDD:409353 1/4 (25%)
Ig 2018..2108 CDD:472250 8/92 (9%)
Ig strand B 2034..2038 CDD:409353 0/3 (0%)
Ig strand C 2047..2051 CDD:409353 0/3 (0%)
Ig strand E 2074..2078 CDD:409353 0/3 (0%)
Ig strand F 2088..2093 CDD:409353 1/4 (25%)
Ig strand G 2101..2104 CDD:409353 0/2 (0%)
Ig 2113..2214 CDD:472250 13/100 (13%)
Ig strand B 2130..2134 CDD:409353 0/3 (0%)
Ig strand C 2143..2147 CDD:409353 0/3 (0%)
Ig strand E 2176..2185 CDD:409353 3/8 (38%)
Ig strand F 2195..2200 CDD:409353 1/4 (25%)
I-set 2220..2302 CDD:400151 23/81 (28%)
Ig strand B 2238..2242 CDD:409353 0/3 (0%)
Ig strand C 2251..2255 CDD:409353 0/3 (0%)
Ig strand E 2277..2281 CDD:409353 1/3 (33%)
Ig strand F 2291..2296 CDD:409353 1/4 (25%)
Ig strand G 2304..2307 CDD:409353 0/2 (0%)
I-set 2318..2408 CDD:400151 31/91 (34%)
Ig strand B 2335..2339 CDD:409353 1/3 (33%)
Ig strand C 2348..2352 CDD:409353 1/3 (33%)
Ig strand E 2374..2378 CDD:409353 1/3 (33%)
Ig strand F 2388..2393 CDD:409353 1/4 (25%)
Ig 2415..2506 CDD:472250 18/91 (20%)
Ig strand B 2432..2436 CDD:409353 2/3 (67%)
Ig strand C 2445..2449 CDD:409353 0/3 (0%)
Ig strand E 2472..2476 CDD:409353 1/3 (33%)
Ig strand F 2486..2491 CDD:409353 2/4 (50%)
Ig strand G 2499..2502 CDD:409353 1/2 (50%)
I-set 2519..2608 CDD:400151 11/88 (13%)
Ig strand B 2536..2540 CDD:409353 1/3 (33%)
Ig strand C 2549..2553 CDD:409353 0/3 (0%)
Ig strand E 2574..2578 CDD:409353 0/3 (0%)
Ig strand F 2588..2593 CDD:409353 0/4 (0%)
I-set 2615..2696 CDD:400151 14/83 (17%)
Ig strand B 2632..2636 CDD:409353 0/3 (0%)
Ig strand C 2645..2649 CDD:409353 1/3 (33%)
Ig strand E 2670..2674 CDD:409353 0/3 (0%)
Ig strand F 2684..2689 CDD:409353 1/7 (14%)
Ig strand G 2697..2700 CDD:409353 0/2 (0%)
I-set 2717..2805 CDD:400151 17/87 (20%)
Ig strand B 2734..2738 CDD:409353 1/3 (33%)
Ig strand C 2747..2751 CDD:409353 0/3 (0%)
Ig strand E 2773..2777 CDD:409353 0/3 (0%)
Ig strand F 2787..2792 CDD:409353 0/4 (0%)
Ig strand G 2800..2803 CDD:409353 1/2 (50%)
FN3 2834..2925 CDD:238020 23/143 (16%)
Ig <2996..3063 CDD:472250 13/66 (20%)
Ig strand C 3003..3007 CDD:409353 1/3 (33%)
Ig strand E 3029..3033 CDD:409353 0/3 (0%)
Ig strand F 3043..3048 CDD:409353 2/4 (50%)
Ig strand G 3056..3059 CDD:409353 1/2 (50%)
Ig 3067..3157 CDD:472250 17/86 (20%)
Ig strand B 3085..3088 CDD:409353 0/2 (0%)
Ig strand C 3097..3101 CDD:409353 1/3 (33%)
Ig strand E 3123..3127 CDD:409353 1/3 (33%)
Ig strand F 3137..3142 CDD:409353 1/4 (25%)
Ig strand G 3150..3153 CDD:409353 2/3 (67%)
PK_Unc-89_rpt1 3182..3440 CDD:271011
Ig 3654..3744 CDD:472250
Ig strand B 3671..3675 CDD:409353
Ig strand C 3684..3688 CDD:409353
Ig strand E 3710..3714 CDD:409353
Ig strand F 3724..3729 CDD:409353
Ig strand G 3737..3740 CDD:409353
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
zorminNP_001261317.1 SPEC 126..332 CDD:238103 29/208 (14%)
SPEC <504..641 CDD:413338 29/141 (21%)
SMC_prok_B 654..>1389 CDD:274008 132/828 (16%)
Smc <1192..>1377 CDD:440809 31/203 (15%)
I-set 1390..1479 CDD:400151 33/94 (35%)
Ig strand B 1407..1411 CDD:409564 2/3 (67%)
Ig strand C 1420..1424 CDD:409564 1/3 (33%)
Ig strand E 1445..1449 CDD:409564 1/3 (33%)
Ig strand F 1459..1464 CDD:409564 2/4 (50%)
Ig strand G 1472..1475 CDD:409564 0/2 (0%)
I-set 1491..1580 CDD:400151 22/90 (24%)
Ig strand B 1508..1512 CDD:409353 0/3 (0%)
Ig strand C 1521..1525 CDD:409353 1/3 (33%)
Ig strand E 1546..1550 CDD:409353 1/5 (20%)
Ig strand F 1560..1565 CDD:409353 3/4 (75%)
Ig strand G 1573..1576 CDD:409353 1/2 (50%)
I-set 1589..1675 CDD:400151 28/89 (31%)
Ig strand B 1606..1610 CDD:409353 1/3 (33%)
Ig strand C 1619..1623 CDD:409353 1/3 (33%)
Ig strand E 1641..1645 CDD:409353 1/3 (33%)
Ig strand F 1655..1660 CDD:409353 1/4 (25%)
Ig strand G 1668..1671 CDD:409353 0/2 (0%)
I-set 1702..1786 CDD:400151 28/135 (21%)
Ig strand B 1714..1718 CDD:409353 1/24 (4%)
Ig strand C 1727..1731 CDD:409353 0/3 (0%)
Ig strand E 1752..1756 CDD:409353 1/3 (33%)
Ig strand F 1766..1771 CDD:409353 2/4 (50%)
Ig strand G 1779..1782 CDD:409353 1/2 (50%)
I-set 1811..1902 CDD:400151 28/93 (30%)
Ig strand B 1828..1832 CDD:409353 1/3 (33%)
Ig strand C 1841..1845 CDD:409353 0/3 (0%)
Ig strand E 1868..1872 CDD:409353 1/3 (33%)
Ig strand F 1882..1887 CDD:409353 1/4 (25%)
I-set 1927..2015 CDD:400151 21/89 (24%)
Ig strand B 1944..1948 CDD:409353 1/3 (33%)
Ig strand C 1957..1961 CDD:409353 0/3 (0%)
Ig strand E 1981..1985 CDD:409353 1/3 (33%)
Ig strand F 1995..2000 CDD:409353 0/4 (0%)
Ig strand G 2008..2011 CDD:409353 0/2 (0%)
Ig 2142..2231 CDD:472250 24/90 (27%)
Ig strand B 2159..2163 CDD:409353 0/3 (0%)
Ig strand C 2172..2176 CDD:409353 0/3 (0%)
Ig strand E 2197..2201 CDD:409353 1/3 (33%)
Ig strand F 2211..2216 CDD:409353 1/4 (25%)
Ig strand G 2224..2227 CDD:409353 0/2 (0%)
I-set 2238..2325 CDD:400151 31/87 (36%)
Ig strand B 2255..2259 CDD:409353 1/3 (33%)
Ig strand C 2268..2272 CDD:409353 1/3 (33%)
Ig strand F 2309..2314 CDD:409353 1/4 (25%)
PHA03247 <2593..2893 CDD:223021 70/398 (18%)
I-set 3566..3655 CDD:400151
Ig strand B 3583..3587 CDD:409353
Ig strand C 3596..3600 CDD:409353
Ig strand E 3621..3625 CDD:409353
Ig strand F 3635..3640 CDD:409353
Ig strand G 3648..3651 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.