DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and hmcn2

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:XP_031747766.1 Gene:hmcn2 / 100490941 XenbaseID:XB-GENE-6034990 Length:4625 Species:Xenopus tropicalis


Alignment Length:4063 Identity:830/4063 - (20%)
Similarity:1375/4063 - (33%) Gaps:1261/4063 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 PIQRIND--YQLLFKDFIKYSLSLKENVKDL-ERALELMLSVPSR--------------AYDNRF 266
            |.||::.  |..:..|.  .::.:.|.::.. ||.|.|..||.|.              ..|..|
 Frog   401 PFQRLSSVAYTSIIPDI--PTVFMPELIQGYHERLLRLTCSVLSEIPFRLRFSKDGERLGEDQFF 463

  Fly   267 LSSIEGCRGNIYKLGRLLLHAW--------------CNVVDKEGKAHDRYCFLFKSRILVTKVRK 317
            :.|     ||.         .|              |..:.|.|..:.|           |||..
 Frog   464 MES-----GNA---------TWEIPSASARHEGTYLCTAMSKAGGGYAR-----------TKVSV 503

  Fly   318 ISENRSVFILQNIV------KLPLCNI--ELKADEKQIH--------------------LSLKAP 354
            .....::.:..||.      .:..|.:  |::.:....|                    |:.:|.
 Frog   504 ADPPPTLAVTHNITTFVGGSAILSCEVLGEIRYNLTWAHSGKAFREGRVRILANSSLEILNAQAS 568

  Fly   355 EANSFLPIDIKPHGPEAHLTWFNEISSHINQDVTLQEHNADDLKVDASQIASESELILH------ 413
            :|..:.......||......|           :|:|...:.::|..:.|::...|:.|.      
 Frog   569 DAGEYQCTASNDHGATTASLW-----------LTIQAPPSIEIKSSSMQLSHGEEVTLRCDVSGN 622

  Fly   414 -LPQRAEAHDPNLSVRPSDVAENYFLSKETKERLQHEQQELLK-LEQEAIELYKKQQSSKSVSSK 476
             :||.:..|            |:.|||..::..:......|:| ..||....| ...:|.|:.:.
 Frog   623 PVPQVSWKH------------EDSFLSNGSRYTVLDNSTLLIKDAGQEDAGNY-SCVASNSLGTD 674

  Fly   477 TESVEITSSQVKSSSEVRKVVSPPPPPQAQVKEVTPVKVVSSPPPPKEITPAKVATPPPQPQVVT 541
            .::|.:|..:...::.|:.:|..|      :.|...::.:|...||..:|..|            
 Frog   675 EQTVFLTYVERPKATAVKALVLVP------LGEDAILECLSEGLPPPVVTWYK------------ 721

  Fly   542 SPVKEVAPPPQPRAVASPAKEVTPSQSEPVKAPSPIKEVRKEVPPSASHSKEVEALVATEIRESL 606
                             ..||||.::|........::|||.|       .....|.||:.     
 Frog   722 -----------------DDKEVTGTESGTNGGTLKLQEVRAE-------DGGKYACVASN----- 757

  Fly   607 TETRSTVVESGQSSEIREEIVVTEESSLEGKQVVALEREPS---PCS-----IPKIQVYRPVECE 663
                    .:|.:|:|.:..|.|....::....|.:|...|   |||     .|::..:|  :.|
 Frog   758 --------NAGTASDIIQVDVGTPPQFIDFPLDVEVEVGDSASLPCSAEGNPTPQVSWFR--QDE 812

  Fly   664 NPVVTKHKPIELKDIVGYSESLRDGDTAPAGGSPGRQQGYSANITDHASLTIWNNR--LANIAGD 726
            .|||..          |.:|.:....:........|.:..:..:.:..:...|...  |.::.| 
 Frog   813 GPVVPS----------GTTEIIEGPGSNTVHFKVARPEDAAVYVCEARNAFGWVQAEILLSVTG- 866

  Fly   727 RSGANQHLQQSGPPPPPIPPNFTRMPGFFQPLPLIAYETTIEILIVKARP-PSPPPPPPPTIKRV 790
                     .:.|.........|.:.|         :..|:...:|...| |         ::|.
 Frog   867 ---------LAAPKLAVASSEVTVLEG---------HSVTLPCTVVSGNPLP---------VQRW 904

  Fly   791 LVHTESLEQKTQNFFEGIYDAASSDTSLRNAKQKIRSIKSTVLKSKDSTNYAQDTVQKAKARDFL 855
            ..::|:|:.:.::...|............:|.:..    ..|..:..|||::          ..|
 Frog   905 TKNSEALQVQWRHSINGEGGLLIEPVQREDAGKYF----CEVTNAAGSTNHS----------ILL 955

  Fly   856 HIFTPPVKKRPIYEIVEEPVNIFELEGDYTESIADDFREPSADFEARGQSVGGMDDYYSGYSRAS 920
            |:...||       |:..|......||          |......:.:|                 
 Frog   956 HVHVAPV-------ILSGPAEYVVREG----------RAVIMSCDVKG----------------- 986

  Fly   921 TRRYETKTRDYDRGTSYDSTVERSQYGISSRRDRSSVDKVEARSSLLATGRTESRAASRAESRAE 985
               |...|..:.:| ..:.|.|.:.|.::  :|.|.:..       |.||..    ......:|.
 Frog   987 ---YPPPTVTWSKG-DLELTQENTHYYLN--KDGSIMIS-------LPTGAD----GGSYTCKAV 1034

  Fly   986 SRASYSVAESRAGIRSSSRLQEDRPLRSVDKPVVVKMLKSVQVEPGETAHFEIQFKDQPGLVTWL 1050
            :.|..|:.:.|..:.:..|:..:   .|.|:...|:::.::..|  .|...:::....| :|:|.
 Frog  1035 NPAGVSIRDVRLIVHTKPRISIN---GSHDQNAPVRVVAALGTE--ITLPCDVEGSPLP-VVSWR 1093

  Fly  1051 KDNKPLEDRLADRITQTAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHD 1115
            ||:.||     ..::.....:.|:.|.:......|:|.|:..|.:.:..|:::..|.|...|   
 Frog  1094 KDSLPL-----PIVSARHHLLPSWSLRLSELRVMDSGYYSCLASNPAGNTSLTYSLEVQVPP--- 1150

  Fly  1116 ETKTNTEPAFLVSLKDAEMIENTLFRFM---VKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKD 1177
                ...|.       |::::..|.|.:   ....|||.||:.:|||.:.:.        :.|:|
 Frog  1151 ----RVHPG-------AKVLKALLGRTLQLPCLAYGDPMPRLSWYKDGEPMR--------VGDQD 1196

  Fly  1178 YL----GFYELVIADVQKTDAGTYSCKATNKHGEANCE-----AIATTVEDKNPF----GALSGQ 1229
            .|    |  .:.:.:||.:|:|.|.|.||:..||.:.|     ..|.|.||.:..    .|....
 Frog  1197 SLQGPDG--SISVLEVQLSDSGNYRCVATSSAGEDSLEFRLEVLEAPTFEDGSDVLLEQTAYEPV 1259

  Fly  1230 ILPAGEK----PVFQWKRNGEEFDPEERFKVLFGE-----DEDSLALVFQHVKPEDAGIYTCVAQ 1285
            ||....:    |:.:|.:||         .||.|.     ...:.:|:.:...|...|.|.|||.
 Frog  1260 ILTCPVQGTPTPLIRWMKNG---------VVLVGNLPGMTQLGNGSLLIESPVPNHGGDYICVAT 1315

  Fly  1286 TSTGNISCSAELSVQGAIQTLNREPEKPTLVIEHREANASIGGSAILELQCK--GFPKPAVQWKH 1348
            ...|:.....:|.|..          ||.:..:.:..|.|:..:..|.|:|:  |.|.|.|.|..
 Frog  1316 NEAGSARRKTKLVVYA----------KPKIFEDGQGKNISVMANQPLTLRCEVSGVPFPTVTWSK 1370

  Fly  1349 DGEVIQVDDRHKFMYEDEESMSLV-------IKNVDTVDAGVYTIEAINELGQDESSINLVVKAP 1406
            ||:.:          .:...:||:       ...:...|.|.||.:|:|..|:.:.:.||::..|
 Frog  1371 DGKAL----------TEAPGLSLLAAGQSVRFHRIRKDDTGSYTCKAVNRAGEAQRTFNLMILVP 1425

  Fly  1407 PKI---KKITDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDV-TAESNVKISSSSIGKSLEKVV 1467
            |.|   ..:.|:|...|..:::..:..|.|:|.|:.|.:|:.: ..:::::::...       .|
 Frog  1426 PSIYGAGSLQDMTARDGSEVELHCKASGVPRPQVEWTKDGQPLPPGDAHIQLTEGG-------QV 1483

  Fly  1468 VEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSKPVIVKNFE----SEYIHGEKENVQMTVRI 1528
            :::...:||..|.|...|.|...|..:.::..|.:.|.|..:.|    :..:||   .|::....
 Frog  1484 LQLNGTRLSDQGRYQCLAFNHAGQQVKDFNLRVHTPPTIWASNETTEVASLLHG---TVELRCEA 1545

  Fly  1529 DAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQL 1593
            .|.|...:||:.|:..| ::.|:.|....|.  :|:::.....|.|.||.:|||..|:|..|.:|
 Frog  1546 RASPVPGITWFKDKRPI-VSSSRATYREGGR--SLQLSRVLLSDVGTYTCRATNNAGTAEKSYRL 1607

  Fly  1594 LIKCAPEFT---HKLKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGND 1655
            .:..:|:..   .|...|....|.: :||......:|.|...|..||:.:.|:  |...:::|..
 Frog  1608 EVYVSPDIEGGGSKPLPIKAILGQA-LELECSATGHPPPTLSWLKDGLMLSER--DGLQIKDGGR 1669

  Fly  1656 FKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKPKVKRG--------------------- 1699
             .|.:..|:...||.:||..::..|:...:..|||...|||..|                     
 Frog  1670 -TLYIGIVSEGTQGTFTCVAISLAGENVLHYTVTVLVPPKVVIGEGSEHVTVTANDPLDLSCHAT 1733

  Fly  1700 ---------LKN------------------------------------------------VEVQE 1707
                     |:|                                                |||||
 Frog  1734 GYPTPTIQWLRNNHSLSHEDGVEVLNGGKMLTIRQIQPEHAGKYKCKAEGDSGTAEAWVEVEVQE 1798

  Fly  1708 GKSFT----------------LEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTL 1756
            ..|.|                ||.:|...|...:.|:|||..:             .::...|.:
 Frog  1799 LPSVTIAGGTTMVVNFLKRVVLECDVSGSPPPSVTWWKDGFLL-------------PVQGPKLQI 1850

  Fly  1757 NLARTEDAGTYEMKATNFIGETTSTCKVAVLTS---EALSLEQTVTKTLIATTE-----EP---- 1809
            :....:|.|.|...||||.||......:.||.|   |...:.|||.:.|.|:.|     .|    
 Frog  1851 DSVSIDDEGVYTCVATNFAGEGRQDVVLTVLVSPNIEPSDVNQTVIENLPASFECLASGSPLPLV 1915

  Fly  1810 ------------------EEGAVPEIVHVDVFQQHSYE--------SVPLKYEVI---------- 1838
                              .||...:|..........|.        |..|:|.::          
 Frog  1916 SWYRGEQLLSAAPGITLLNEGKTLQIESAKSSDSGEYRCVASNTAGSTELQYNLLVNVAPRIVSM 1980

  Fly  1839 -----------------ATGIPKPEAIWYHDGKPITPDKHTAIT---VDGDHYKLEVQSLDLVDA 1883
                             |||:|:|..:|..|..|::    |||.   :......|.:::..:.|:
 Frog  1981 MDFATFLVNEQVWLECNATGVPEPAIMWLKDQVPVS----TAIAGLQIMEQGRILSLRAAHVSDS 2041

  Fly  1884 GEYKVVVQNKVGEKSH------------QGELSLSGIAEYRKPILTQGPGLKDIKVNKGDKVCEP 1936
            |.|..|..|..||.||            .||...|.|| ..:|:|.:               |:.
 Frog  2042 GIYSCVAVNPAGEDSHHIALQVFVPPTIMGEELNSSIA-VNQPLLLE---------------CQS 2090

  Fly  1937 VVFTADPAPEIVLLKDGQPVVETNNVK-------LKVDK---KDA-------------------- 1971
               ||.|.|.|..||||:|:::...|:       |::|:   :||                    
 Frog  2091 ---TAIPPPLITWLKDGRPLLQRPGVQVIDDGHYLQIDQAQLRDAGRYTCEASNDAGRTEKHYNV 2152

  Fly  1972 -------------------ENGLVQYTC--------------------------------TLNIL 1985
                               |...|.:||                                .|.|.
 Frog  2153 IIWVPPSFPEPSAPHHSIIEGQPVSFTCECTGVPPPTLTWTKNGLPLTVEDSGLVSAGGRLLQIG 2217

  Fly  1986 EAEIKDSGRYELKVKNKYGELVTSGWIDVLAKPEISGLNDT-KCL---PGDTICFEALVQANPKP 2046
            :.::.|.|.|..:..|:.|......|::|.|:|.|:|.::| |.|   .|..:..|.:|...|.|
 Frog  2218 KVQLSDEGSYICECSNQAGSNKKEYWLEVYAQPMIAGSSNTPKQLMVNKGSLVTMECVVSGKPSP 2282

  Fly  2047 KVSWTRGNENLCNHENCEVIADVDADKYRLVFQS---------VSPCEDGKYTITATNSEGRAAV 2102
            .|:|.:....|.|..:             |.||:         ..|...|:|...|.|:.|:..:
 Frog  2283 SVTWLKDGYPLGNGPD-------------LFFQNKGQQLTILKAQPSHSGRYVCVAVNAAGQTDI 2334

  Fly  2103 DFNLAVLVEKPTFIVQPE----SQSIHDYRPVSTKVLVHGVPLPTIEWFKDDKPINYEAINKPGK 2163
            .:.:.|.|.......|.|    |.|:|....::.:..  |:|.|.|.||:     |.||::.  :
 Frog  2335 KYEVFVQVPPELPNTQTELLNVSTSLHGTFTITCEAT--GIPPPVITWFR-----NNEALSP--R 2390

  Fly  2164 DKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGVTKAPFKLAMLSLAPSFVKKLDN 2228
            :.::.:...:        ||.|...:..|.|.||||.||..|..|..|.:.:| :.||...:.||
 Frog  2391 ENVHLQSGGR--------VLRITHAQIQDAGHYTCVVTNTAGQAKKDFFVDIL-VPPSIDGEDDN 2446

  Fly  2229 ALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYK 2293
            .|.|.:|:.:.|.|.|.|.|.|.:.||:|...|:..:.:.||  ||| .:|.|.|....:.|.|.
 Frog  2447 DLRVPEGQSVTLSCKVSGHPKPLITWLRDSQPVQSGDEVLIS--PDG-SELHIQSANVFNVGHYT 2508

  Fly  2294 LIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQT-----VVVGEPLKLEAQVTGFPAPEVKWYK 2353
            .|..|...|:.....|.|.   :.|....|:..:.     |:|..|..|..:..|||.|.|.|.|
 Frog  2509 CIAINSIAERSRSYIVTVL---VSPTISGPLDDEANEDVIVIVNNPFSLICEALGFPIPSVTWLK 2570

  Fly  2354 DGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVSKVEI----VPKESK 2414
            :|...:.|..:..:  |.|. ||.|..||..|:|.|.|::.|:.||.....:|::    |.|...
 Frog  2571 NGEPFKDSDNLRLL--PGGH-GLQILNAQEEDSGQYTCVVTNEVGEAIRNYEVKVFIPPVIKRDD 2632

  Fly  2415 PVFVAELQDASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKT 2479
            |.....:::..:.....:.:..:....|||.|.|:.:|..::....    |:...:...|.::..
 Frog  2633 PHQDVGIKEVKTKVNSSLTLQCESQAVPKPTLHWYKDGQLLESSGG----VQILSDGQELQLQPI 2693

  Fly  2480 APGDSGLYEVIAQNPEGSTASKAKLYV---------APKADETATEEAPQFVSALRDVNAD---E 2532
            ...|||.|..:|.|..|.  .:.:.||         .|.:...|.|..|      ||.:.:   |
 Frog  2694 RLSDSGRYTCVATNVAGE--DEKEFYVNVQVPPIFHRPGSPSAAFELVP------RDDDEEELTE 2750

  Fly  2533 GQELVLSAPFI------SNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTC 2591
            .:|:|.:.|..      :.|.|.:.|.|||..|:.::.:|:..:|:.  |.|..|.|..:|.|||
 Frog  2751 HREVVATNPISLYCDTNAIPPPILTWYKDGQLLSSSDGVLILLEGRI--LQIPMAHAKHAGKYTC 2813

  Fly  2592 LLANPLGEDSSACNANVRKVYK-----PPVFTQKISDQQQ----VFGNNAKIPVTVSGVPYPDLE 2647
            ...|..|||        |..|:     |||...::.:..|    ::...|::....||:|.|.:.
 Frog  2814 EATNEAGED--------RLHYELVVLTPPVMKGEVDELIQEVSVIYNQTAELHCDASGIPPPSIT 2870

  Fly  2648 WYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREG------------------ 2694
            |......:..:|:|.|.|:|  ..|.:::.:..|...|.|:|.|..|                  
 Frog  2871 WLRNGLTLSTAERYQILNEG--KTLQIHSVQVSDIDSYVCVAENPAGFAERLFTLMVHVTPVISG 2933

  Fly  2695 ------KDITQGRLDIVNEIKKHSRSEPPVFLKKIGDCDIYEGMVAKFTACATGYPEPEVEWFKN 2753
                  ..:.|..:.:|.:::.|                                |.||:.|:|:
 Frog  2934 PNPENISAVLQSSVSLVCDVQSH--------------------------------PTPEIMWYKD 2966

  Fly  2754 DQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYG--DDICHAELFYDSLDSQQKP 2816
            .|.|.|:...|  |.|.|.: |.|..|...:.|.|.|::.||.|  :.:.|..::          
 Frog  2967 GQLLTPTKGLL--IMPGGQV-LQIARVQMSNQGIYMCKVHNPAGSAEKLLHLIVY---------- 3018

  Fly  2817 LEDQYTDFKKYKKSGAPPPLSEGP-----IISRMTDRGLLLSWNPSVPLTPRYPITYQIEMMDLP 2876
                           .||.:.|.|     .:.|:.|                 .:|.|.|...||
 Frog  3019 ---------------VPPSIKEPPNGKQETVVRLGD-----------------SLTLQCESDALP 3051

  Fly  2877 EG--DW-----RTLRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLVPDPP 2934
            ..  .|     :.|..||      :|    ..|:..|:.:.: ...||...||... ..:..:..
 Frog  3052 RPTITWYKNGHQLLENGV------VR----IHDHGQRLEILD-IKASDKGQYTCKV-ANMAGEVE 3104

  Fly  2935 KTYTYL--PPGTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVKDHNTELMWFVY 2997
            .|||.:  .|.|..||:.                   :..|.::          .::..|.....
 Frog  3105 LTYTVIINVPATIVRPQN-------------------ETIQLII----------GNSIVLSCEAE 3140

  Fly  2998 GYPKPKMTYYFDDMLIESG-------GRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGEA 3055
            |.|.|.:|:..|...::||       |           :.|.|.::.....|.|..:|.|...|.
 Frog  3141 GSPSPVVTWLKDGEPLDSGVWGVAIRG-----------SRLQITRVQQSHAGRYRCIAQNSISET 3194

  Fly  3056 RQRVRLEIAEHPRFL--KRPDETFIMARKNGRIEAKLVGIPLPEVHWFKDWKP----IVDSSRIK 3114
            .:...|.:...||..  :.|.|..:..::..::|.|..|.|.|::.||||..|    :|.::|: 
 Frog  3195 HKDFVLLVQVAPRIFGSEMPSEHSVPEKQEVKLECKTEGTPAPQILWFKDGNPLDVTLVPNTRV- 3258

  Fly  3115 ISSYDPDIYVL-SIHDSIIKDGGLYSISARNIAGSISTSVTVHIEENEDQYIYKTYGRHPYVRSK 3178
              ..|.:..|| |:..|   |.|.|:..|||.||             ||..:|......|.:   
 Frog  3259 --FQDGNFLVLRSVQAS---DSGRYTCVARNNAG-------------EDTRVYVLNILVPPI--- 3302

  Fly  3179 QLRYQDKYDIGDELGR---GTQGITYHAVERSSGDNYAAKIMY---GRPELRPFMLNELEMMNTF 3237
               ::...:..|.|..   |...:..||    || :...|:.:   |.|                
 Frog  3303 ---FESGSNASDVLSSVPGGQVTLECHA----SG-SLPLKLSWFKDGHP---------------- 3343

  Fly  3238 NHKNLIRPYDAYDTDRSVTLIMELAAGGELVRDNLLR---RDYYT----------ERDIAHYIRQ 3289
                       ..|.|.|    .:|:||.::|.:.::   ...||          |::...:|..
 Frog  3344 -----------LSTSRYV----RIASGGRILRFSQVQVSDAGTYTCVASSPAGAAEKNFVLHIES 3393

  Fly  3290 --TLWGLEHMHEMGV-----------GHMGLTIKDLLISVVGGDIIKVSDF---GLSRKINRHNL 3338
              .|...|...|:..           .| |..:..|.....|..:...|:.   ||..:::..::
 Frog  3394 LPVLERSESTEEVTAIKGASVTFTCEAH-GTPLPSLSWEKDGQPLNLQSNLLPNGLGTRLHLESV 3457

  Fly  3339 STLDYGMPEFVSPEVVNKEGVNFSHDMWTV---------GLITYVLLGGHNPFLGIDDRETLTKI 3394
            ..||.|:...::   ||..|....|...||         .|.|.|.:...:| |.:....|....
 Frog  3458 RALDSGIYSCIA---VNAAGRVSKHFHLTVLEPPRIEGPALPTEVSIIADSP-LELACTATGVPT 3518

  Fly  3395 REGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWFFMLDRPVYDHDYQIGTDRL 3459
            .|..|:          .|||                   .|.||.....:..|.         |:
 Frog  3519 PEISWE----------KDGR-------------------PLSHPDLLTRNGTVL---------RI 3545

  Fly  3460 RNYYDHFRDWYANASCKNYFRRRRLSGCFQHPSKMVYPPGHVYTPENTPEPL------------- 3511
            ..........|...:.....|..|.:..     :|..||..|.:.|  |..|             
 Frog  3546 ERVKAEDAGIYVCVATSTAGRDSRATWV-----RMKVPPSVVGSTE--PRSLAVSVGGQLVLECK 3603

  Fly  3512 ----PEPRIRAKREEVVSKYLHPDYELGLIQSESHYQYGPDTYLLQLRDVNFPVRLREYMKVAHR 3572
                |.|.|:..|.::.   |..|   |.:|..|..:|      :|:..:. |....||..:|  
 Frog  3604 VEADPPPTIQWYRGDIP---LQTD---GRVQVLSKGRY------VQIHSLR-PSDSGEYTCIA-- 3653

  Fly  3573 RSPSFALNDSVDWSLPVIRERRRFTDIMDEEIDDERTRSRISMYAANESYSIRRLRTELGPRLDE 3637
                         |.|..|....||                                        
 Frog  3654 -------------SNPAGRTSLHFT---------------------------------------- 3665

  Fly  3638 YTEADAMIETQREGYPPFFREKPQTIAITENQPSHIHCFAVGDPKPCVQWFKNDMVLT-ESKRIK 3701
                   :|.|   ..|..:..|..::::.||.:.:.|...|.|.|...|.|:...|: |..|::
 Frog  3666 -------VEIQ---LAPMIQPGPSVVSVSVNQTAVLPCRMEGIPLPVASWRKDGSPLSVEISRME 3720

  Fly  3702 ISVDEDGRSILRFEPALHFDVGVYKVVARNKVG 3734
            ...|    ..||...||..|.|.|.....|..|
 Frog  3721 FLAD----GSLRIPQALLQDSGYYLCTVTNSAG 3749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091 12/43 (28%)
PH_unc89 275..388 CDD:270134 21/154 (14%)
Not5 <477..>652 CDD:444384 34/182 (19%)
Ig 1017..1108 CDD:472250 18/90 (20%)
Ig strand B 1034..1038 CDD:409353 0/3 (0%)
Ig strand C 1046..1050 CDD:409353 1/3 (33%)
Ig strand E 1074..1078 CDD:409353 1/3 (33%)
Ig strand F 1088..1093 CDD:409353 1/4 (25%)
Ig strand G 1101..1104 CDD:409353 0/2 (0%)
I-set 1123..1212 CDD:400151 27/100 (27%)
Ig strand B 1140..1144 CDD:409353 1/6 (17%)
Ig strand C 1153..1157 CDD:409353 1/3 (33%)
Ig strand E 1182..1186 CDD:409353 0/3 (0%)
Ig strand F 1196..1201 CDD:409353 2/4 (50%)
Ig strand G 1209..1212 CDD:409353 1/7 (14%)
Ig <1236..1299 CDD:472250 16/71 (23%)
Ig strand C 1238..1242 CDD:409353 0/3 (0%)
Ig strand E 1259..1269 CDD:409353 2/14 (14%)
Ig strand F 1279..1284 CDD:409353 2/4 (50%)
Ig strand G 1292..1295 CDD:409353 0/2 (0%)
I-set 1313..1403 CDD:400151 24/98 (24%)
Ig strand B 1330..1334 CDD:409353 1/3 (33%)
Ig strand C 1343..1347 CDD:409353 1/3 (33%)
Ig strand E 1369..1373 CDD:409353 2/10 (20%)
Ig strand F 1383..1388 CDD:409353 2/4 (50%)
Ig strand G 1396..1399 CDD:409353 0/2 (0%)
Ig_3 1406..1487 CDD:464046 18/84 (21%)
I-set 1499..1595 CDD:400151 28/99 (28%)
Ig strand B 1522..1526 CDD:409353 1/3 (33%)
Ig strand C 1535..1539 CDD:409353 1/3 (33%)
Ig strand E 1561..1565 CDD:409353 1/3 (33%)
Ig strand F 1575..1580 CDD:409353 2/4 (50%)
Ig strand G 1588..1591 CDD:409353 0/2 (0%)
Ig 1599..1690 CDD:472250 22/93 (24%)
Ig strand B 1617..1621 CDD:409353 2/3 (67%)
Ig strand C 1630..1634 CDD:409353 0/3 (0%)
Ig strand E 1656..1660 CDD:409353 1/3 (33%)
Ig strand F 1670..1675 CDD:409353 2/4 (50%)
Ig strand G 1683..1686 CDD:409353 0/2 (0%)
I-set 1694..1786 CDD:400151 31/185 (17%)
Ig strand B 1711..1715 CDD:409353 2/19 (11%)
Ig strand C 1724..1728 CDD:409353 0/3 (0%)
Ig strand E 1752..1756 CDD:409353 1/3 (33%)
Ig strand F 1766..1771 CDD:409353 1/4 (25%)
Ig strand G 1779..1782 CDD:409353 0/2 (0%)
Ig <1836..1903 CDD:472250 22/108 (20%)
Ig strand C 1846..1850 CDD:409353 0/3 (0%)
Ig strand E 1871..1875 CDD:409353 1/3 (33%)
Ig strand F 1885..1890 CDD:409353 1/4 (25%)
Ig 1922..2005 CDD:472250 26/163 (16%)
Ig strand B 1933..1937 CDD:409353 1/3 (33%)
Ig strand C 1946..1950 CDD:409353 1/3 (33%)
Ig strand E 1971..1984 CDD:409353 6/83 (7%)
Ig strand F 1994..1999 CDD:409353 1/4 (25%)
Ig 2018..2108 CDD:472250 24/102 (24%)
Ig strand B 2034..2038 CDD:409353 0/3 (0%)
Ig strand C 2047..2051 CDD:409353 1/3 (33%)
Ig strand E 2074..2078 CDD:409353 1/3 (33%)
Ig strand F 2088..2093 CDD:409353 1/4 (25%)
Ig strand G 2101..2104 CDD:409353 0/2 (0%)
Ig 2113..2214 CDD:472250 28/104 (27%)
Ig strand B 2130..2134 CDD:409353 0/3 (0%)
Ig strand C 2143..2147 CDD:409353 1/3 (33%)
Ig strand E 2176..2185 CDD:409353 2/8 (25%)
Ig strand F 2195..2200 CDD:409353 3/4 (75%)
I-set 2220..2302 CDD:400151 29/81 (36%)
Ig strand B 2238..2242 CDD:409353 1/3 (33%)
Ig strand C 2251..2255 CDD:409353 0/3 (0%)
Ig strand E 2277..2281 CDD:409353 1/3 (33%)
Ig strand F 2291..2296 CDD:409353 1/4 (25%)
Ig strand G 2304..2307 CDD:409353 0/2 (0%)
I-set 2318..2408 CDD:400151 30/94 (32%)
Ig strand B 2335..2339 CDD:409353 1/3 (33%)
Ig strand C 2348..2352 CDD:409353 1/3 (33%)
Ig strand E 2374..2378 CDD:409353 2/3 (67%)
Ig strand F 2388..2393 CDD:409353 2/4 (50%)
Ig 2415..2506 CDD:472250 16/90 (18%)
Ig strand B 2432..2436 CDD:409353 0/3 (0%)
Ig strand C 2445..2449 CDD:409353 1/3 (33%)
Ig strand E 2472..2476 CDD:409353 1/3 (33%)
Ig strand F 2486..2491 CDD:409353 1/4 (25%)
Ig strand G 2499..2502 CDD:409353 0/2 (0%)
I-set 2519..2608 CDD:400151 28/97 (29%)
Ig strand B 2536..2540 CDD:409353 1/3 (33%)
Ig strand C 2549..2553 CDD:409353 0/3 (0%)
Ig strand E 2574..2578 CDD:409353 1/3 (33%)
Ig strand F 2588..2593 CDD:409353 3/4 (75%)
I-set 2615..2696 CDD:400151 21/108 (19%)
Ig strand B 2632..2636 CDD:409353 1/3 (33%)
Ig strand C 2645..2649 CDD:409353 0/3 (0%)
Ig strand E 2670..2674 CDD:409353 1/3 (33%)
Ig strand F 2684..2689 CDD:409353 2/4 (50%)
Ig strand G 2697..2700 CDD:409353 0/2 (0%)
I-set 2717..2805 CDD:400151 22/89 (25%)
Ig strand B 2734..2738 CDD:409353 0/3 (0%)
Ig strand C 2747..2751 CDD:409353 1/3 (33%)
Ig strand E 2773..2777 CDD:409353 1/3 (33%)
Ig strand F 2787..2792 CDD:409353 2/4 (50%)
Ig strand G 2800..2803 CDD:409353 0/2 (0%)
FN3 2834..2925 CDD:238020 21/102 (21%)
Ig <2996..3063 CDD:472250 16/73 (22%)
Ig strand C 3003..3007 CDD:409353 1/3 (33%)
Ig strand E 3029..3033 CDD:409353 1/3 (33%)
Ig strand F 3043..3048 CDD:409353 1/4 (25%)
Ig strand G 3056..3059 CDD:409353 0/2 (0%)
Ig 3067..3157 CDD:472250 29/96 (30%)
Ig strand B 3085..3088 CDD:409353 0/2 (0%)
Ig strand C 3097..3101 CDD:409353 0/3 (0%)
Ig strand E 3123..3127 CDD:409353 2/4 (50%)
Ig strand F 3137..3142 CDD:409353 1/4 (25%)
Ig strand G 3150..3153 CDD:409353 0/2 (0%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 54/301 (18%)
Ig 3654..3744 CDD:472250 23/82 (28%)
Ig strand B 3671..3675 CDD:409353 0/3 (0%)
Ig strand C 3684..3688 CDD:409353 0/3 (0%)
Ig strand E 3710..3714 CDD:409353 1/3 (33%)
Ig strand F 3724..3729 CDD:409353 1/4 (25%)
Ig strand G 3737..3740 CDD:409353
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
hmcn2XP_031747766.1 vWFA 29..165 CDD:238119
IG_like 434..503 CDD:214653 18/93 (19%)
Ig strand B 434..438 CDD:409353 2/3 (67%)
Ig strand C 447..451 CDD:409353 0/3 (0%)
Ig strand E 469..473 CDD:409353 1/12 (8%)
Ig strand F 483..488 CDD:409353 1/4 (25%)
Ig 514..592 CDD:472250 11/88 (13%)
Ig strand B 524..528 CDD:409353 0/3 (0%)
Ig strand C 537..541 CDD:409353 0/3 (0%)
Ig strand E 558..562 CDD:409353 0/3 (0%)
Ig strand F 572..577 CDD:409353 0/4 (0%)
Ig strand G 585..588 CDD:409353 0/2 (0%)
I-set 596..681 CDD:400151 19/97 (20%)
Ig strand B 613..617 CDD:409353 1/3 (33%)
Ig strand C 626..630 CDD:409353 1/3 (33%)
Ig strand E 648..652 CDD:409353 0/3 (0%)
Ig strand F 662..667 CDD:409353 1/5 (20%)
Ig strand G 676..679 CDD:409353 0/2 (0%)
Ig 695..770 CDD:472250 23/129 (18%)
Ig strand B 703..707 CDD:409353 0/3 (0%)
Ig strand C 716..720 CDD:409353 1/3 (33%)
Ig strand E 736..740 CDD:409353 0/3 (0%)
Ig strand F 750..755 CDD:409353 1/4 (25%)
Ig strand G 763..766 CDD:409353 1/2 (50%)
IG_like 780..864 CDD:214653 17/95 (18%)
Ig strand B 791..795 CDD:409353 0/3 (0%)
Ig strand C 804..808 CDD:409353 0/3 (0%)
Ig strand F 844..849 CDD:409353 0/4 (0%)
I-set 870..957 CDD:400151 17/118 (14%)
Ig strand B 887..891 CDD:409353 1/3 (33%)
Ig strand C 901..905 CDD:409353 1/3 (33%)
Ig strand E 923..927 CDD:409353 0/3 (0%)
Ig strand F 937..942 CDD:409353 0/8 (0%)
Ig strand G 950..953 CDD:409353 1/12 (8%)
I-set 961..1048 CDD:400151 23/137 (17%)
Ig strand B 978..982 CDD:409353 0/3 (0%)
Ig strand C 991..995 CDD:409353 1/3 (33%)
Ig strand E 1014..1018 CDD:409353 1/3 (33%)
Ig strand F 1028..1033 CDD:409353 0/4 (0%)
Ig 1065..1146 CDD:472250 18/88 (20%)
Ig strand B 1076..1080 CDD:409353 1/3 (33%)
Ig strand C 1089..1093 CDD:409353 1/3 (33%)
Ig strand E 1112..1116 CDD:409353 1/3 (33%)
Ig strand F 1126..1131 CDD:409353 1/4 (25%)
Ig strand G 1139..1142 CDD:409353 0/2 (0%)
Ig 1157..1237 CDD:472250 25/89 (28%)
Ig strand B 1167..1171 CDD:409353 0/3 (0%)
Ig strand C 1180..1184 CDD:409353 1/3 (33%)
Ig strand E 1203..1207 CDD:409353 1/5 (20%)
Ig strand F 1217..1222 CDD:409353 2/4 (50%)
Ig strand G 1230..1233 CDD:409353 0/2 (0%)
Ig 1241..1329 CDD:472250 22/96 (23%)
Ig strand B 1259..1263 CDD:409353 2/3 (67%)
Ig strand C 1272..1276 CDD:409353 0/3 (0%)
Ig strand E 1295..1299 CDD:409353 1/3 (33%)
Ig strand F 1309..1314 CDD:409353 2/4 (50%)
Ig strand G 1322..1325 CDD:409353 0/2 (0%)
I-set 1342..1420 CDD:400151 21/87 (24%)
Ig strand B 1352..1356 CDD:409353 2/3 (67%)
Ig strand C 1365..1369 CDD:409353 1/3 (33%)
Ig strand E 1387..1392 CDD:409353 0/4 (0%)
Ig strand F 1402..1407 CDD:409353 2/4 (50%)
Ig strand G 1415..1418 CDD:409353 0/2 (0%)
I-set 1434..1516 CDD:400151 17/88 (19%)
Ig strand B 1445..1449 CDD:409353 0/3 (0%)
Ig strand C 1458..1462 CDD:409353 1/3 (33%)
Ig strand E 1481..1486 CDD:409353 1/11 (9%)
Ig strand F 1496..1501 CDD:409353 1/4 (25%)
I-set 1538..1609 CDD:400151 22/73 (30%)
Ig strand B 1539..1543 CDD:409353 1/3 (33%)
Ig strand C 1552..1556 CDD:409353 1/3 (33%)
Ig strand E 1574..1579 CDD:409353 2/6 (33%)
Ig strand F 1589..1594 CDD:409353 2/4 (50%)
Ig strand G 1602..1605 CDD:409353 0/2 (0%)
Ig 1621..1703 CDD:472250 21/85 (25%)
Ig strand B 1633..1637 CDD:409353 2/3 (67%)
Ig strand C 1646..1650 CDD:409353 0/3 (0%)
Ig strand E 1668..1673 CDD:409353 1/5 (20%)
Ig strand F 1683..1688 CDD:409353 2/4 (50%)
I-set 1717..1796 CDD:400151 3/78 (4%)
Ig strand C 1739..1743 CDD:409353 0/3 (0%)
Ig strand E 1762..1766 CDD:409353 0/3 (0%)
Ig strand F 1776..1781 CDD:409353 0/4 (0%)
Ig 1796..1880 CDD:472250 23/96 (24%)
Ig strand B 1818..1822 CDD:409353 1/3 (33%)
Ig strand C 1831..1835 CDD:409353 0/3 (0%)
Ig strand F 1860..1865 CDD:409353 1/4 (25%)
Ig strand G 1873..1876 CDD:409353 0/2 (0%)
I-set 1886..1964 CDD:400151 13/77 (17%)
Ig strand B 1901..1905 CDD:409353 1/3 (33%)
Ig strand C 1914..1918 CDD:409353 0/3 (0%)
Ig strand E 1936..1941 CDD:409353 1/4 (25%)
Ig strand F 1951..1956 CDD:409353 1/4 (25%)
Ig 1984..2063 CDD:472250 21/82 (26%)
Ig strand B 1992..1996 CDD:409353 0/3 (0%)
Ig strand C 2005..2009 CDD:409353 0/3 (0%)
Ig strand E 2029..2033 CDD:409353 1/3 (33%)
Ig strand F 2043..2048 CDD:409353 1/4 (25%)
Ig strand G 2056..2059 CDD:409353 2/2 (100%)
Ig_3 2066..2141 CDD:464046 23/93 (25%)
Ig 2170..2246 CDD:472250 12/75 (16%)
Ig strand B 2176..2180 CDD:409353 1/3 (33%)
Ig strand C 2189..2193 CDD:409353 0/3 (0%)
Ig strand E 2204..2216 CDD:409353 1/11 (9%)
Ig strand F 2226..2231 CDD:409353 1/4 (25%)
Ig strand G 2239..2242 CDD:409353 0/2 (0%)
I-set 2259..2340 CDD:400151 20/93 (22%)
Ig strand B 2270..2274 CDD:409353 0/3 (0%)
Ig strand C 2283..2287 CDD:409353 1/3 (33%)
Ig strand E 2306..2310 CDD:409353 0/3 (0%)
Ig strand F 2320..2325 CDD:409353 1/4 (25%)
Ig 2364..2424 CDD:409353 20/76 (26%)
Ig strand B 2364..2368 CDD:409353 0/3 (0%)
Ig strand C 2377..2381 CDD:409353 1/3 (33%)
Ig strand E 2400..2404 CDD:409353 2/11 (18%)
Ig strand F 2414..2419 CDD:409353 3/4 (75%)
I-set 2447..2526 CDD:400151 27/81 (33%)
Ig strand B 2456..2460 CDD:409353 1/3 (33%)
Ig strand C 2469..2473 CDD:409353 0/3 (0%)
Ig strand E 2492..2496 CDD:409353 1/3 (33%)
Ig strand F 2506..2511 CDD:409353 1/4 (25%)
Ig strand G 2519..2522 CDD:409353 0/2 (0%)
I-set 2530..2622 CDD:400151 30/94 (32%)
Ig strand B 2552..2556 CDD:409353 1/3 (33%)
Ig strand C 2565..2569 CDD:409353 1/3 (33%)
Ig strand E 2588..2592 CDD:409353 2/4 (50%)
Ig strand F 2602..2607 CDD:409353 2/4 (50%)
I-set 2633..2720 CDD:400151 18/92 (20%)
Ig strand B 2650..2654 CDD:409353 0/3 (0%)
Ig strand C 2663..2667 CDD:409353 1/3 (33%)
Ig strand E 2686..2690 CDD:409353 1/3 (33%)
Ig strand F 2700..2705 CDD:409353 1/4 (25%)
Ig 2760..2830 CDD:472250 23/79 (29%)
Ig strand B 2760..2764 CDD:409353 0/3 (0%)
Ig strand C 2773..2777 CDD:409353 0/3 (0%)
Ig strand E 2797..2800 CDD:409353 1/4 (25%)
Ig strand F 2810..2815 CDD:409353 3/4 (75%)
I-set 2839..2925 CDD:400151 19/87 (22%)
Ig strand B 2855..2859 CDD:143224 1/3 (33%)
Ig strand C 2868..2872 CDD:143224 0/3 (0%)
Ig strand E 2891..2895 CDD:143224 1/3 (33%)
Ig strand F 2905..2910 CDD:143224 2/4 (50%)
Ig strand G 2918..2921 CDD:143224 0/2 (0%)
I-set 2929..3017 CDD:400151 25/122 (20%)
Ig strand B 2947..2951 CDD:409353 0/3 (0%)
Ig strand C 2960..2964 CDD:409353 1/3 (33%)
Ig strand E 2983..2987 CDD:409353 1/4 (25%)
Ig strand F 2997..3002 CDD:409353 2/4 (50%)
Ig strand G 3010..3013 CDD:409353 0/2 (0%)
I-set 3034..3111 CDD:400151 21/105 (20%)
Ig strand B 3041..3045 CDD:143207 1/3 (33%)
Ig strand C 3054..3058 CDD:143207 0/3 (0%)
Ig strand E 3077..3081 CDD:143207 1/3 (33%)
Ig strand F 3091..3096 CDD:143207 2/4 (50%)
Ig_3 3116..3189 CDD:464046 18/112 (16%)
Ig_3 3206..3284 CDD:464046 25/83 (30%)
I-set 3318..3391 CDD:400151 18/108 (17%)
Ig strand B 3321..3325 CDD:409353 0/3 (0%)
Ig strand C 3334..3338 CDD:409353 1/3 (33%)
Ig strand E 3357..3361 CDD:409353 0/3 (0%)
Ig strand F 3371..3376 CDD:409353 2/4 (50%)
I-set 3406..3484 CDD:400151 14/81 (17%)
Ig strand B 3414..3418 CDD:409353 0/3 (0%)
Ig strand C 3427..3431 CDD:409353 1/3 (33%)
Ig strand E 3450..3454 CDD:409353 0/3 (0%)
Ig strand F 3464..3469 CDD:409353 0/4 (0%)
Ig strand G 3477..3480 CDD:409353 0/2 (0%)
Ig 3488..3568 CDD:472250 18/118 (15%)
Ig strand B 3507..3511 CDD:409353 1/3 (33%)
Ig strand C 3520..3524 CDD:409353 1/3 (33%)
Ig strand E 3541..3545 CDD:409353 1/12 (8%)
Ig strand F 3555..3560 CDD:409353 1/4 (25%)
I-set 3585..3668 CDD:400151 23/159 (14%)
Ig strand B 3598..3602 CDD:409353 0/3 (0%)
Ig strand C 3611..3615 CDD:409353 1/3 (33%)
Ig strand E 3633..3638 CDD:409353 1/10 (10%)
Ig strand F 3648..3653 CDD:409353 2/4 (50%)
Ig strand G 3661..3664 CDD:409353 0/2 (0%)
I-set 3672..3759 CDD:400151 23/82 (28%)
Ig strand B 3689..3693 CDD:409353 0/3 (0%)
Ig strand C 3702..3706 CDD:409353 0/3 (0%)
Ig strand E 3725..3729 CDD:409353 1/3 (33%)
Ig strand F 3739..3744 CDD:409353 1/4 (25%)
TSP1 3766..3817 CDD:214559
TSP1 3822..3873 CDD:214559
nidG2 3876..4088 CDD:469646
EGF_CA 4111..4149 CDD:214542
EGF_CA 4151..4184 CDD:429571
EGF_CA 4196..4233 CDD:214542
EGF_CA 4234..4267 CDD:214542
EGF_CA 4276..4307 CDD:429571
EGF_CA 4319..4348 CDD:429571
EGF_CA 4424..4463 CDD:214542
EGF_CA 4464..4504 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.