DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vmat and Slc18b1

Sequence 1:NP_001014525.1 Gene:Vmat FlyBaseID:FBgn0260964 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_898939.2 Gene:Slc18b1 MGIID:1923556 Length:457 Species:Mus musculus

Alignment Length:368 Identity:100/369 (27%)
Similarity:164/369 (44%) Gaps:52/369 (14%)


  Fly   239 VGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLS---TIIFAF------GRSYLVL- 293
            :|::|...|..:||.:.:.|.....||......||   ||:|   ||:|..      |..::.: 
Mouse    72 IGMIFGCYALFELLASLVFGKYLVHIGAKFMFIAG---MFVSGGVTILFGVLDQLPEGPIFIAMC 133

  Fly   294 FVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGL----ALGVLIGPPFGGVMYEFV 354
            |:.|.:..||...:..:...:||..|.      |.:...:|.|    .||::.|||.||::|:..
Mouse   134 FLVRIVDAIGFGAAITASSSILAKAFP------NNVATVMGSLEVFSGLGLVAGPPLGGLLYQSF 192

  Fly   355 GKSAPFLILAALALGDGLLQLFMLQPSIQKAETEP--PSLKSLISDPYILIAAGAITFANMGIAM 417
            |...||:.|..:.|....|.|::| ||.   |::|  .|...|::.|.:.:.|..|...:.....
Mouse   193 GYEVPFIFLGCIVLLMIPLNLYIL-PSY---ESDPGKQSFWKLVTLPKMGLLAFVIISLSSCFGF 253

  Fly   418 LEPSLPLWMVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHK---IGRWFAACLGLIIIGGCL 479
            |:|:|.|::::....:....|:.||..|:||.|.:.|||.|..|   :.:|... .|.:|..||.
Mouse   254 LDPTLSLFVMEKFSLSTGYVGLVFLGLSLSYAISSPLFGLLSDKMPTLRKWLLV-FGNLITAGCY 317

  Fly   480 IF---IPM---ATSITHLIIPNAGLGFAIGMVDSSMMPEL---GYLVDIRHS-AVYGSVYALGDV 534
            :.   :|:   .:.:..|::.....|.:.||......||:   .|......| :..|.|..|...
Mouse   318 MLLGPVPLLHIKSQLWLLVLVLVVNGISAGMSIIPTFPEMLSCAYANGFEDSISTLGLVSGLFGA 382

  Fly   535 AFCVGFAVGPALSGSLVKSIGFEW---------MLFGIAILCF 568
            .:.||..:||.|.|.|.:.|||||         :|.|:::..|
Mouse   383 MWSVGAFMGPILGGFLCEKIGFEWAAAMQGLWTLLSGVSMALF 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VmatNP_001014525.1 MFS 238..578 CDD:119392 100/369 (27%)
MFS_1 238..544 CDD:284993 88/334 (26%)
Slc18b1NP_898939.2 MFS 37..426 CDD:119392 100/369 (27%)
MFS_1 48..392 CDD:284993 88/334 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3764
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.