DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vmat and slc18a2

Sequence 1:NP_001014525.1 Gene:Vmat FlyBaseID:FBgn0260964 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_017945375.1 Gene:slc18a2 ID: Length:406 Species:Xenopus tropicalis

Alignment Length:412 Identity:200/413 (48%)
Similarity:253/413 (61%) Gaps:92/413 (22%)


  Fly   181 PR---TPLTSNVPPPPT--PCPCNKDGSEAAPLEISTISPEENETYYRELEERHNELVGETVEVG 240
            ||   ||.:|..|.|||  |..|.:..|                           .|:.|.|:||
 Frog    45 PRSAVTPTSSPSPSPPTAPPADCPRADS---------------------------SLLNENVKVG 82

  Fly   241 LLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSS 305
            |||||||.||||.||.:||:|:||||.|||||||.|||:|||                       
 Frog    83 LLFASKATVQLLTNPFIGPMTNRIGYQIPMFAGFCIMFVSTI----------------------- 124

  Fly   306 CSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGD 370
                                                ||||||.::||||||:||||:||.|.|.|
 Frog   125 ------------------------------------IGPPFGSILYEFVGKTAPFLVLAVLVLFD 153

  Fly   371 GLLQLFMLQPSIQKAETEPPS-LKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGATR 434
            |.||||:||||..:.|::..: |.:||.|||||||||:|.||||.||||||:||:||::.|.:.:
 Frog   154 GALQLFVLQPSRVQPESQTGTPLLTLIRDPYILIAAGSICFANMAIAMLEPALPIWMMETMCSRK 218

  Fly   435 WEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLIIIGGCLIFIPMATSITHLIIPNAGLG 499
            |:.||||||||||||||||:||||.||:|||..|.:|:|::|..:|.:|.|.:|..||.|..|:|
 Frog   219 WQLGVAFLPASISYLIGTNVFGPLAHKMGRWLCAFIGMIVVGISIICVPFARNIYGLIAPTFGVG 283

  Fly   500 FAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPALSGSLVKSIGFEWMLFGIA 564
            ||||||||||||.:|||||:||.:|||||||:.|||||:|||.||:..|::.|||||.|::..|.
 Frog   284 FAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGFAFGPSAGGAIAKSIGFPWLMTIIG 348

  Fly   565 ILCFMYAPLLTLLKNPPTSDEK 586
            ::..::|||...|::||..:||
 Frog   349 VVDVLFAPLCLFLRSPPAREEK 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VmatNP_001014525.1 MFS 238..578 CDD:119392 181/341 (53%)
MFS_1 238..544 CDD:284993 168/307 (55%)
slc18a2XP_017945375.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D406900at33208
OrthoFinder 1 1.000 FOG0000325
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.