DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vmat and LOC101731380

Sequence 1:NP_001014525.1 Gene:Vmat FlyBaseID:FBgn0260964 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_017947996.1 Gene:LOC101731380 ID: Length:81 Species:Xenopus tropicalis

Alignment Length:81 Identity:46/82 (56%)
Similarity:59/82 (72%) Gaps:13/82 (16%)


  Fly   283 IFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFG 347
            :|||..||.:|||||:|||||:|.:|||||.:||:::|||||||.||||||||:|||:       
 Frog    11 MFAFASSYSLLFVARSLQGIGTSFTSVSGMAILANKYTDDKERGEAMGIALGGVALGL------- 68

  Fly   348 GVMYEFVGKSAPFLIL 363
                  ||||..|.::
 Frog    69 ------VGKSMAFTLV 78

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VmatNP_001014525.1 MFS 238..578 CDD:119392 46/82 (56%)
MFS_1 238..544 CDD:284993 46/82 (56%)
LOC101731380XP_017947996.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000325
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.