DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and TBP2

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001321103.1 Gene:TBP2 / 841999 AraportID:AT1G55520 Length:200 Species:Arabidopsis thaliana

Alignment Length:170 Identity:37/170 - (21%)
Similarity:75/170 - (44%) Gaps:11/170 - (6%)


  Fly   130 MDFNCRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKISSTALNAD-----SARS 189
            ::.:|:..:..:.|....:.::|....:|:::|..|.....|.|.||:..|...::     :|| 
plant    32 VNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEHLSKLAAR- 95

  Fly   190 GLFKVIRILQDLDYKVDIMNFS-KNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRRPFITYTTE 253
               |..||:|.|.:.....:|. :||| .|..:.|.|.|:.::..|....:......|.:.|..:
plant    96 ---KYARIVQKLGFPAKFKDFKIQNIV-GSCDVKFPIRLEGLAYSHSAFSSYEPELFPGLIYRMK 156

  Fly   254 NLGVRFAVFPTGFVLVLHSTSHCETREAIANFLPILAKLK 293
            ...:...:|.:|.:::..:....||..|..|..|:|.:.:
plant   157 LPKIVLLIFVSGKIVITGAKMREETYTAFENIYPVLREFR 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 16/74 (22%)
PLN00062 131..294 CDD:177693 37/169 (22%)
TBP 213..291 CDD:278767 18/77 (23%)
TBP2NP_001321103.1 PLN00062 22..200 CDD:177693 37/170 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.