DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9879 and Tbpl1

DIOPT Version :8

Sequence 1:NP_608699.1 Gene:CG9879 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_006227783.1 Gene:Tbpl1 / 689030 RGDID:1597456 Length:218 Species:Rattus norvegicus

Alignment Length:169 Identity:40/170 (24%)
Similarity:74/170 (44%) Gaps:8/170 (5%)


  Fly   113 AEIEEKLELHFRPFTCVMDFNCRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKI 177
            |:.:..|::......||....|..::.::.|..|...: ......|::|:..|.....|.:.|||
  Rat     3 ADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIY-KRDVGKVLMKLRKPRITATIWSSGKI 66

  Fly   178 SST-ALNADSARSGLFKVIRILQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRHVVEVAQN 241
            ..| |.:.:.|:.|..::.|.||.|.::|...:|....|.|..:|||:|.|...::.:....:..
  Rat    67 ICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYE 131

  Fly   242 RSRRPFITYTTENLGVRFAVFPTGFVLV------LHSTS 274
            ....|.:.|..::|.....:|.||.:.|      :|:.|
  Rat   132 PELHPAVCYRIKSLRATLQIFSTGSITVTGNLDLMHTCS 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9879NP_608699.1 TBP 128..200 CDD:278767 19/73 (26%)
PLN00062 131..294 CDD:177693 36/152 (24%)
TBP 213..291 CDD:278767 16/69 (23%)
Tbpl1XP_006227783.1 TLF 9..212 CDD:239953 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.