DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9879 and tbpl2

DIOPT Version :8

Sequence 1:NP_608699.1 Gene:CG9879 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_005169867.1 Gene:tbpl2 / 407713 ZFINID:ZDB-GENE-040520-3 Length:313 Species:Danio rerio

Alignment Length:304 Identity:59/305 (19%)
Similarity:113/305 (37%) Gaps:51/305 (17%)


  Fly    20 NDARFDGVKLKEGTSAKLSSLDKLFEELKISKESSAKEDL----VTEPMKTE---SYLYKDYFNK 77
            :|..|:|....:|::::|.  |..|.....|:|....|||    :.:.:.|:   |.:.|:..|:
Zfish    21 SDYIFEGDLGLQGSTSQLQ--DSSFLSSLASQEKDLTEDLDLSFLPDELSTQDEPSQVEKESKNE 83

  Fly    78 SP---IDFPWEKAYEKGSSLGPDFYIDYENIFDNVANLAEIEEKLELHFRPFT------------ 127
            ..   .|.|.:::.:..        ||       .:|.|:...:..|...|.|            
Zfish    84 DSGIYTDCPQKESTQAD--------ID-------TSNSAQNTSQFNLPMTPMTPMTPMTPVAESS 133

  Fly   128 ----------CVMDFNCRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKISSTAL 182
                      ..::..|...:..:.|....:.::|....:|:::|..|.....|.:.||:..|..
Zfish   134 GIIPQLQNIVSTVNLACPLDLKSIALQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGA 198

  Fly   183 NADSARSGLF--KVIRILQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRR 245
            .:...:|.|.  |..|::|.|.:....::|....:..|..:.|.|.|:.:...|....:......
Zfish   199 KSSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVCFPIRLEGLVLTHQQFSSYEPELF 263

  Fly   246 PFITYTTENLGVRFAVFPTGFVLVLHSTSHCETREAIANFLPIL 289
            |.:.|......:...:|.:|.|::..:....|..||..|..|||
Zfish   264 PGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPIL 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9879NP_608699.1 TBP 128..200 CDD:278767 15/74 (20%)
PLN00062 131..294 CDD:177693 34/162 (21%)
TBP 213..291 CDD:278767 17/78 (22%)
tbpl2XP_005169867.1 PLN00062 136..312 CDD:177693 34/173 (20%)
TBP_eukaryotes 136..310 CDD:239952 34/173 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10126
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.