DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and tbpl2

DIOPT Version :9

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_005169867.1 Gene:tbpl2 / 407713 ZFINID:ZDB-GENE-040520-3 Length:313 Species:Danio rerio


Alignment Length:304 Identity:59/304 - (19%)
Similarity:113/304 - (37%) Gaps:51/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NDARFDGVKLKEGTSAKLSSLDKLFEELKISKESSAKEDL----VTEPMKTE---SYLYKDYFNK 77
            :|..|:|....:|::::|.  |..|.....|:|....|||    :.:.:.|:   |.:.|:..|:
Zfish    21 SDYIFEGDLGLQGSTSQLQ--DSSFLSSLASQEKDLTEDLDLSFLPDELSTQDEPSQVEKESKNE 83

  Fly    78 SP---IDFPWEKAYEKGSSLGPDFYIDYENIFDNVANLAEIEEKLELHFRPFT------------ 127
            ..   .|.|.:::.:..        ||       .:|.|:...:..|...|.|            
Zfish    84 DSGIYTDCPQKESTQAD--------ID-------TSNSAQNTSQFNLPMTPMTPMTPMTPVAESS 133

  Fly   128 ----------CVMDFNCRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKISSTAL 182
                      ..::..|...:..:.|....:.::|....:|:::|..|.....|.:.||:..|..
Zfish   134 GIIPQLQNIVSTVNLACPLDLKSIALQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGA 198

  Fly   183 NADSARSGLF--KVIRILQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRR 245
            .:...:|.|.  |..|::|.|.:....::|....:..|..:.|.|.|:.:...|....:......
Zfish   199 KSSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVCFPIRLEGLVLTHQQFSSYEPELF 263

  Fly   246 PFITYTTENLGVRFAVFPTGFVLVLHSTSHCETREAIANFLPIL 289
            |.:.|......:...:|.:|.|::..:....|..||..|..|||
Zfish   264 PGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPIL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP 128..200 CDD:278767 14/73 (19%)
PLN00062 131..294 CDD:177693 34/161 (21%)
TBP 213..291 CDD:278767 17/77 (22%)
tbpl2XP_005169867.1 PLN00062 136..312 CDD:177693 34/172 (20%)
TBP_eukaryotes 136..310 CDD:239952 34/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10126
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.