DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9879 and TBPL2

DIOPT Version :8

Sequence 1:NP_608699.1 Gene:CG9879 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_950248.1 Gene:TBPL2 / 387332 HGNCID:19841 Length:375 Species:Homo sapiens

Alignment Length:302 Identity:61/303 (20%)
Similarity:117/303 (39%) Gaps:35/303 (12%)


  Fly    21 DARFDGVKLKEGTSAKLSSLDKLFEELKISKESSAKEDLVTEPMKTESYLYKDYFNKSP---IDF 82
            |..|:.....:.||...||:|..|...::::|:  |:..|....:||    ::..::||   :..
Human    78 DTAFNSNPEVKETSGDFSSVDLSFLPDEVTQEN--KDQPVISKHETE----ENSESQSPQSRLPS 136

  Fly    83 PWEKAYEKG---SSLGPDFYIDYENIFDNV-----------ANLAEIEEKLEL-----------H 122
            |.|:....|   |||.......:....|:|           .:||.|.....:           .
Human   137 PSEQDVGLGLNSSSLSNSHSQLHPGDTDSVQPSPEKPNSDSLSLASITPMTPMTPISECCGIVPQ 201

  Fly   123 FRPFTCVMDFNCRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKISST-ALNADS 186
            .:.....::..|:..:.::.|....:.::|....:|:::|..|.....|.:.||:..| |.:.:.
Human   202 LQNIVSTVNLACKLDLKKIALHAKNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQ 266

  Fly   187 ARSGLFKVIRILQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRRPFITYT 251
            :|....|..|::|.|.:....::|....:..|..:.|.|.|:.:...|....:......|.:.|.
Human   267 SRLAARKYARVVQKLGFPARFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYR 331

  Fly   252 TENLGVRFAVFPTGFVLVLHSTSHCETREAIANFLPILAKLK 293
            .....:...:|.:|.|::..:....|..||..|..|||...|
Human   332 MVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGFK 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9879NP_608699.1 TBP 128..200 CDD:278767 15/73 (21%)
PLN00062 131..294 CDD:177693 35/165 (21%)
TBP 213..291 CDD:278767 17/78 (22%)
TBPL2NP_950248.1 EB1_binding <79..131 CDD:283565 14/58 (24%)
PLN00062 199..374 CDD:177693 35/176 (20%)
TBP_eukaryotes 199..372 CDD:239952 34/173 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10126
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.