DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9879 and tbp

DIOPT Version :8

Sequence 1:NP_608699.1 Gene:CG9879 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_956390.1 Gene:tbp / 368882 ZFINID:ZDB-GENE-030616-563 Length:302 Species:Danio rerio

Alignment Length:161 Identity:34/161 - (21%)
Similarity:68/161 - (42%) Gaps:1/161 - (0%)


  Fly   130 MDFNCRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKISST-ALNADSARSGLFK 193
            ::..|:..:..:.|....:.::|....:|:::|..|.....|.:.||:..| |.:.:.:|....|
Zfish   135 VNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARK 199

  Fly   194 VIRILQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVR 258
            ..|::|.|.:....::|....:..|..:.|.|.|:.:...|....:......|.:.|......:.
Zfish   200 YARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIV 264

  Fly   259 FAVFPTGFVLVLHSTSHCETREAIANFLPIL 289
            ..:|.:|.|::..:....|..||..|..|||
Zfish   265 LLIFVSGKVVLTGAKVRGEIYEAFENIYPIL 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9879NP_608699.1 TBP 128..200 CDD:278767 14/70 (20%)
PLN00062 131..294 CDD:177693 34/160 (21%)
TBP 213..291 CDD:278767 17/77 (22%)
tbpNP_956390.1 PLN00062 125..301 CDD:177693 34/161 (21%)
TBP_eukaryotes 125..298 CDD:239952 34/161 (21%)
1. {ECO:0000255} 128..204 14/68 (21%)
2. {ECO:0000255} 218..295 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10126
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.