DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and tbp

DIOPT Version :10

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_956390.1 Gene:tbp / 368882 ZFINID:ZDB-GENE-030616-563 Length:302 Species:Danio rerio


Alignment Length:161 Identity:34/161 - (21%)
Similarity:68/161 - (42%) Gaps:1/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 MDFNCRFSMYELCLLLAESRFDPSSHPSVVVKITHPSAQVKIHAGGKISST-ALNADSARSGLFK 193
            ::..|:..:..:.|....:.::|....:|:::|..|.....|.:.||:..| |.:.:.:|....|
Zfish   135 VNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARK 199

  Fly   194 VIRILQDLDYKVDIMNFSKNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVR 258
            ..|::|.|.:....::|....:..|..:.|.|.|:.:...|....:......|.:.|......:.
Zfish   200 YARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIV 264

  Fly   259 FAVFPTGFVLVLHSTSHCETREAIANFLPIL 289
            ..:|.:|.|::..:....|..||..|..|||
Zfish   265 LLIFVSGKVVLTGAKVRGEIYEAFENIYPIL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP_TLF 131..>234 CDD:447593 21/103 (20%)
TBP 213..292 CDD:425630 17/77 (22%)
tbpNP_956390.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..81
PLN00062 125..301 CDD:177693 34/161 (21%)
1. /evidence=ECO:0000255 128..204 14/68 (21%)
2. /evidence=ECO:0000255 218..295 15/76 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.