DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9879 and Trf

DIOPT Version :8

Sequence 1:NP_608699.1 Gene:CG9879 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_476939.1 Gene:Trf / 34102 FlyBaseID:FBgn0010287 Length:224 Species:Drosophila melanogaster

Alignment Length:214 Identity:46/214 - (21%)
Similarity:76/214 - (35%) Gaps:21/214 - (9%)


  Fly   101 DYENIFDNVA-----------------NLAEIEEK---LELHFRPFTCVMDFNCRFSMYELCLLL 145
            |.|...||||                 .:|.:|.|   .|:..:........||...:..:....
  Fly     9 DAERDRDNVAATSNAAANPHAALQPQQPVALVEPKDAQHEIRLQNIVATFSVNCELDLKAINSRT 73

  Fly   146 AESRFDPSSHPSVVVKITHPSAQVKIHAGGKISST-ALNADSARSGLFKVIRILQDLDYKVDIMN 209
            ..|.:.|.....|::::..|.....|...||:..| |.|...|..|..|..||||.|.:.|..|.
  Fly    74 RNSEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFME 138

  Fly   210 FSKNIVNASFSMPFKIDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVRFAVFPTGFVLVLHSTS 274
            :....:.|:..:.|.|.|:.::..|....:......|.:.|......:...:|..|.|:...:.|
  Fly   139 YKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKS 203

  Fly   275 HCETREAIANFLPILAKLK 293
            ..:..:.:....|||...:
  Fly   204 RKDIMDCLEAISPILLSFR 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9879NP_608699.1 TBP 128..200 CDD:278767 18/72 (25%)
PLN00062 131..294 CDD:177693 36/164 (22%)
TBP 213..291 CDD:278767 14/77 (18%)
TrfNP_476939.1 PLN00062 49..224 CDD:177693 36/174 (21%)
TBP_eukaryotes 50..221 CDD:239952 36/170 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10126
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.