DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4 and tlf-1

DIOPT Version :10

Sequence 1:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001122474.1 Gene:tlf-1 / 172676 WormBaseID:WBGene00006577 Length:508 Species:Caenorhabditis elegans


Alignment Length:148 Identity:29/148 - (19%)
Similarity:63/148 - (42%) Gaps:10/148 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 PSAQVKIHAGGKISSTALNAD-----SARSGLFKVIRILQDLDYKVDIMNFSKNIVNASFSMPFK 224
            |...:|:::.||:......::     :|||....|.|::.....:|.|.|:..|.|.|:..:||.
 Worm   311 PGCYIKVYSSGKVYIVGCRSEADCKRAARSIARHVQRVMGKTKERVSIRNYRVNNVLATCRLPFG 375

  Fly   225 IDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVRFAVFPTGFVLVLHSTSHCETREAIANFLPIL 289
            |.::.::.::..|..........:.:.:........:..||.:.|..:.|..:..|.::...||:
 Worm   376 IKIEEVAAKYPSESTYEPELSVGLVWRSVTPKATLRIHTTGSITVTGAQSEADVLEVLSKIYPIV 440

  Fly   290 AKLK-----NGYPTAEEK 302
            .:.:     .|...|::|
 Worm   441 LEFRCLERAKGNVAAQKK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4NP_608699.1 TBP_TLF 131..>234 CDD:447593 18/73 (25%)
TBP 213..292 CDD:425630 14/78 (18%)
tlf-1NP_001122474.1 KLF1_2_4_N <183..217 CDD:425360
TLF 266..442 CDD:239953 26/130 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.