DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9879 and tlf-1

DIOPT Version :8

Sequence 1:NP_608699.1 Gene:CG9879 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001122474.1 Gene:tlf-1 / 172676 WormBaseID:WBGene00006577 Length:508 Species:Caenorhabditis elegans

Alignment Length:148 Identity:29/149 (19%)
Similarity:63/149 (42%) Gaps:10/149 (7%)


  Fly   165 PSAQVKIHAGGKISSTALNAD-----SARSGLFKVIRILQDLDYKVDIMNFSKNIVNASFSMPFK 224
            |...:|:::.||:......::     :|||....|.|::.....:|.|.|:..|.|.|:..:||.
 Worm   311 PGCYIKVYSSGKVYIVGCRSEADCKRAARSIARHVQRVMGKTKERVSIRNYRVNNVLATCRLPFG 375

  Fly   225 IDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVRFAVFPTGFVLVLHSTSHCETREAIANFLPIL 289
            |.::.::.::..|..........:.:.:........:..||.:.|..:.|..:..|.::...||:
 Worm   376 IKIEEVAAKYPSESTYEPELSVGLVWRSVTPKATLRIHTTGSITVTGAQSEADVLEVLSKIYPIV 440

  Fly   290 AKLK-----NGYPTAEEK 302
            .:.:     .|...|::|
 Worm   441 LEFRCLERAKGNVAAQKK 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9879NP_608699.1 TBP 128..200 CDD:278767 9/40 (23%)
PLN00062 131..294 CDD:177693 26/139 (19%)
TBP 213..291 CDD:278767 14/78 (18%)
tlf-1NP_001122474.1 TLF 266..442 CDD:239953 26/131 (20%)
PLN00062 268..444 CDD:177693 26/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.905639 Normalized mean entropy S205
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.720

Return to query results.
Submit another query.