DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Drp1 and fzo

Sequence 1:NP_001259946.1 Gene:Drp1 FlyBaseID:FBgn0026479 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_732840.1 Gene:fzo FlyBaseID:FBgn0011596 Length:718 Species:Drosophila melanogaster

Alignment Length:708 Identity:122/709 (17%)
Similarity:220/709 (31%) Gaps:254/709 (36%)


  Fly     1 MEALIPVINKLQDVFNTVGSDSIQLPQIVVLGSQSSGKSSVIESVVGRSFLPRGTGIVTRRPLVL 65
            :|.|....::::.:...:..|.:   ::...|..|:|||:||.:::....||...|         
  Fly    65 LEHLCAFSSRVEAIAKVLSRDRM---KVAFFGRTSNGKSAVINALLHEKILPSAMG--------- 117

  Fly    66 QLIYSPLDDRENRSAENGTSNAEEWGRFLHTKKCF--------TDFDEIRKEIENE-TERAAGSN 121
                                         ||..||        .:.:.::.|.|:| .|.:|.|.
  Fly   118 -----------------------------HTTSCFCQVQANGSNETEHVKVEQEDEHMELSALSQ 153

  Fly   122 KGICPEPINLKIFSTHVVNL------------TLVDLPGITKVPVGDQPEDIEAQIKELVLKYIE 174
            ......|..||..:...||:            .|:|.||:          |:.||:.:.:..|..
  Fly   154 LASAHSPGALKPSTLLQVNMAKNRCSILDYDVVLMDTPGV----------DVTAQLDDCLDSYCM 208

  Fly   175 NPNSIILAVTAANTDMATSEALKLAKDVDPDGRRTLAVVTKLDLMDAGTDAIDILCGRVIPVKLG 239
            :.:..||.:.|.:|  .:....:..||          |.:||.                   :..
  Fly   209 DADVFILVLNAEST--VSRVERQFFKD----------VASKLS-------------------RPN 242

  Fly   240 IIGVMNRSQKDIMDQKHIDDQMKDEAAFLQRKYPTLATRNGTPYLAKTLNRLLMH-------HIR 297
            :..:.||..|....:..::.::||:  .::|....|....|....|:.....:.|       |||
  Fly   243 LFILNNRWDKASSLEPEMEQKVKDQ--HMERCVNLLVDELGVYSTAQEAWERIYHVSALEALHIR 305

  Fly   298 DCLPDLKTRVNIMATQFQSLLNSYGEDVSDKSQTLLQIITKFSSAYCCTIEGTARNIETTELCGG 362
            :                ..:.|..|: ...:.|..|:....||:  |..:..    ::|      
  Fly   306 N----------------GQITNPSGQ-TQQRYQEFLRFENDFSN--CLAVSA----LKT------ 341

  Fly   363 ARMGYIFHETFGRTLDSIHPLAGLSKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPS 427
                     .||..|        ||...||..:::      .|..|      .:::..|.::|..
  Fly   342 ---------KFGPHL--------LSAQKILNQLKS------TLICP------FIEKVSRLIDENK 377

  Fly   428 LRCVEL---------IHEEMQRIVQHCGNEVQQEMLRFPKLHEKIVDVVTQLLRRRLPHTNVMVE 483
            .|...|         :.:|.:..:|:|..|:.:...|..:.      |:...::..:|.:     
  Fly   378 ERRANLNAEIEDWLILMQEDREALQYCFEELTEMTQRVGRC------VLNDQIKTLIPSS----- 431

  Fly   484 NIVAIELAYINTKHPDF-------------HKDAALVPSLLKTDSDPYSQINLGQRRANTPRNHM 535
                 .|::....||:|             |.|..|...:|:..|.|.      ||:.......:
  Fly   432 -----VLSFSQPFHPEFPAQIGQYQRSLCAHLDKLLEDRVLQCLSIPL------QRKILDIEKEI 485

  Fly   536 SPQISSHSA------GSQQPQQQQPPQPNSSQQQYSQVHEQNHVAENSTPSMASTWLSNILPPAP 594
            ...|:.:|.      |..........||:...:.........|..|.:.|..||          |
  Fly   486 GLPIAENSCDWQLIYGLDCQSYMSDFQPDLRFRFSLGFTALWHRLEGNLPLHAS----------P 540

  Fly   595 TRPDSIENSTNNTPVHNNIVSPVKPVNLLPDVPANHNPRRLTDKEQKDCDVIEHLIKS 652
            .|...::|.      |.. .||:.|:     |..||            ..::|.|:||
  Fly   541 FRIQKLQNG------HKK-CSPLPPL-----VNGNH------------WQMLESLVKS 574

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Drp1NP_001259946.1 DLP_1 23..301 CDD:206738 55/306 (18%)
CrfC 88..728 CDD:223771 109/622 (18%)
Dynamin_M 226..507 CDD:279383 48/310 (15%)
GED 643..729 CDD:280391 4/11 (36%)
fzoNP_732840.1 DLP_2 87..334 CDD:206739 62/350 (18%)
Fzo_mitofusin 572..716 CDD:282633 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0699
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.