DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and liph

DIOPT Version :8

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001011098.1 Gene:liph / 496511 XenbaseID:XB-GENE-5847665 Length:460 Species:Xenopus tropicalis

Alignment Length:324 Identity:94/325 (29%)
Similarity:138/325 (42%) Gaps:76/325 (23%)


  Fly    69 KIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSP----DLREAYF 129
            |:|..||||...:..:.::|  .|:..:.:.|....|..|.||:   |.....|    |:.:.:.
 Frog    46 KVQLLLYTRENPKCAQDLNV--DNSTGFQYLNVTRRTVFITHGY---RPTGSPPVWIDDIVKKFL 105

  Fly   130 SVGEYNIIIVDY-------------------ADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHP 175
            .:.::|:|:||:                   ||.:|           ||....:||         
 Frog   106 DIQDFNVIVVDWNRGATTVLYHNAAANTRKVADILK-----------RFIDNMLSQ--------- 150

  Fly   176 RGVQPDDLHFIGYSVGAHIAGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVD 240
             |...|.::.:|.|:||||:|.|.   |...|.:||||.|||....:.|......|..|||.|||
 Frog   151 -GATLDSIYMVGVSLGAHISGFVG---KMYNGSIGRITGLDPAGPLFNGKPPEERLHYTDAQFVD 211

  Fly   241 VLHTGAGILGQWHSSGHADFYVNGGTRQPAC-----VGSATLFQTLACDHTKVTPYFIESITTTR 300
            |:|:....||...|.||.|||.||||.||.|     .||    :...|||.:....:|.|:|.:.
 Frog   212 VVHSDTDGLGYKESLGHIDFYPNGGTDQPGCPKTILAGS----EYFKCDHQRSVFLYIASLTKSC 272

  Fly   301 GFYAGPCPNLFSYLIGWCEPKDSEYV-----LMGEHC----SHKARGNY-----YVTTNAKAPF 350
            ...|.||.:...|.||.| ....|::     ::|.:.    .|..:.|:     :..|.||.|:
 Frog   273 DLVAFPCKSYRDYRIGNC-TDCKEFLPLSCPVLGFYADKWKDHLVKRNHPGTTAFFDTAAKDPY 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 91/319 (29%)
liphNP_001011098.1 Pancreat_lipase_like 45..312 CDD:238363 88/300 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.