DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15390 and AT1G62120

DIOPT Version :8

Sequence 1:NP_608676.2 Gene:CG15390 / 33422 FlyBaseID:FBgn0031419 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_176403.1 Gene:AT1G62120 / 842508 AraportID:AT1G62120 Length:437 Species:Arabidopsis thaliana

Alignment Length:229 Identity:45/230 (20%)
Similarity:89/230 (39%) Gaps:54/230 (23%)


  Fly    85 KRTPDKIISCLEIWRACQFGENLLHLLLTKYPELLDVSDSHQLLSHIGFLQSRVSTSKNVWKCLM 149
            |..||.::|.|   |:..|.::.:..::..:|.||.:.....|...:.||||..::|..:.:.:.
plant    85 KGNPDSVLSLL---RSHGFTDSQISNIIRTFPRLLILDAEKSLAPKLQFLQSIGASSSELTETVS 146

  Fly   150 NSPDLIAQSE-VSIEEKLNFITDVMRIEVPELVKSAALTL---SFEELRCRHQFLLR-LGL---- 205
            ..|.::.:.: .|:....:|:..::..:....::....:|   |.:|.:.|:..:|| :|:    
plant   147 AVPKILGKRKGKSLSRYYDFVKVIIEADKSSKLEKLCHSLPEGSKQENKIRNLLVLREMGVPQRL 211

  Fly   206 -----------------FKPRPPKA-----DPNEPTTNPKLYQITDTSEKSFATKICHVTLPEYE 248
                             ||....||     ||...|....|..:...|:|....|        :.
plant   212 LFSLLISDAGDVCGKEKFKESLKKAVEIGFDPTTATFVKALNVLYGLSDKGIENK--------FN 268

  Fly   249 AFK-------DLYA-----KELEQKSRRKEEDEL 270
            |.|       |::|     ..:..||.:|.|:.:
plant   269 ACKRLGLAVDDVWAMFKKWPNILTKSEKKIENSV 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15390NP_608676.2 mTERF <75..205 CDD:303004 26/125 (21%)
AT1G62120NP_176403.1 mTERF 92..401 CDD:280667 42/223 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13068
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.