DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15390 and AT1G56380

DIOPT Version :8

Sequence 1:NP_608676.2 Gene:CG15390 / 33422 FlyBaseID:FBgn0031419 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001154432.1 Gene:AT1G56380 / 842091 AraportID:AT1G56380 Length:399 Species:Arabidopsis thaliana

Alignment Length:258 Identity:54/259 (21%)
Similarity:90/259 (35%) Gaps:59/259 (23%)


  Fly    26 ATPKILQLEQIHIDEAIKIEPTLAVFSPEIWRRAHQTFQNHGLETVNFLRIVTGNPAILKRTPDK 90
            ||..:..|....::|.:.|..||.....::|....:.                  |..|..:..|
plant   182 ATVVVCTLSNETLEERVNIYKTLGFDVRDVWEMFKKC------------------PTFLNISEKK 228

  Fly    91 IISCLEIWRACQFGENLLHLLLTKYPELLDVSDSHQLLSHIGFLQSRVSTSKNVWKCLMNSPDLI 155
            |....|..:.|...|..:..:..|.|:.:|.|:. .:..:..||:......:.|.......|..|
plant   229 ITQSFETLKKCGLVEEEVISMFQKSPQCIDFSEL-DITQNFEFLKGCGLVEEEVLSMFKRYPQCI 292

  Fly   156 AQSEVSIEEKLNFI----------TDVMRIEVPELVKSAALTLSFEELRCRHQFLLRLGLFKPRP 210
            ..||..|   ||.:          .:||.:...|.|.|..:.|.|             .:.|...
plant   293 GFSEKKI---LNAVETFLGQGFSKDEVMMMVNREGVVSIPVVLEF-------------SMEKMIV 341

  Fly   211 PKADPNEPTTNPKLYQITDTSEKSFATKICHVTLPEYEAFKDLYAKELEQKSRRKEEDELSDE 273
            |:.:..:..|:.:|.: |:.| ..|:..||    |: |.|       ||:...:.::.||.||
plant   342 PRCNVIKALTSKRLLK-TEVS-SMFSVLIC----PD-EVF-------LERYVSKHDDQELVDE 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15390NP_608676.2 mTERF <75..205 CDD:303004 28/140 (20%)
AT1G56380NP_001154432.1 mTERF 63..375 CDD:303004 48/242 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13068
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.