DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15390 and MDA1

DIOPT Version :8

Sequence 1:NP_608676.2 Gene:CG15390 / 33422 FlyBaseID:FBgn0031419 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001327961.1 Gene:MDA1 / 827109 AraportID:AT4G14605 Length:493 Species:Arabidopsis thaliana

Alignment Length:295 Identity:63/296 (21%)
Similarity:107/296 (36%) Gaps:75/296 (25%)


  Fly     8 NTQAVLKQQS--------NLHHIRHLATPKILQLEQIHIDEAIK--IE------------PTLAV 50
            :|:..|:.|:        ||..|:.: |.|........:|..||  :|            ||:..
plant   191 DTEGALRPQTLYLLDLGLNLEQIKTI-TRKFAAFPYYSLDGKIKPVVEFLLDLGIPKSDIPTILC 254

  Fly    51 FSPEI--------WRRAHQTFQNHGLETVNFLRIVTGNPAILKRTPDKIISCLEIWRACQFGENL 107
            ..|:|        .:......:..|::...:.:|::..||||..:..|:.|.:|........|..
plant   255 KRPQICGISLTDNLKPTMAFLETLGIDKNQWAKIISRFPAILTYSRQKLTSTVEFLSQTGLTEEQ 319

  Fly   108 LHLLLTKYPELLDVSDSHQLLSHIGFLQS-RVSTSKNVWKCLMNSPDLIAQSEVSIEEKLNFITD 171
            :..:||:.|.::..|...:|...:.:.:| .|..:..:.:|    |....   :|||..|..:|:
plant   320 IGRILTRCPNIMSYSVEDKLRPTMEYFRSLNVDVAVLLHRC----PQTFG---LSIESNLKPVTE 377

  Fly   172 VMRIEVPELVKSAALTLSFEELR---CRHQFLLRLGLFKPRPPKADPNEPTTNPKLYQITDTSEK 233
            ..      |.|...|    :|:.   .|:..|....|.:...||.|..:....||       ||.
plant   378 FF------LEKGFGL----DEIGIMISRYGALYTFSLKENVMPKWDYFQTMDYPK-------SEL 425

  Fly   234 SFATKICHVTLPEY------EAFKDLYAKELEQKS 262
                    |..|::      |..|..|  ||.|:|
plant   426 --------VKFPQFFGYSLQERIKPRY--ELVQRS 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15390NP_608676.2 mTERF <75..205 CDD:303004 29/134 (22%)
MDA1NP_001327961.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13068
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.