DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15390 and EMB3114

DIOPT Version :8

Sequence 1:NP_608676.2 Gene:CG15390 / 33422 FlyBaseID:FBgn0031419 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_850257.1 Gene:EMB3114 / 818173 AraportID:AT2G36000 Length:333 Species:Arabidopsis thaliana

Alignment Length:257 Identity:50/257 - (19%)
Similarity:96/257 - (37%) Gaps:49/257 - (19%)


  Fly    16 QSNLHHIRHLATPKILQLEQIHIDEAIKIE---PTLAV------------------FSPEIWRR- 58
            :|::|.       |::.|:.:.||....|.   |.|:.                  |:.:.:|| 
plant    70 ESSIHE-------KLIYLDSLGIDFLTLINRHPPLLSTALSAVESVVDYMTTPPINFTLQDFRRL 127

  Fly    59 -------AHQTFQNHGLETVNFLRIVTGNPAI------LKRTPDKIISCL---EIWRACQFGENL 107
                   ......:|.:..:.||....|..:|      |:|.| ::::|.   ::.....|.:.:
plant   128 VSMCPELLTSPLTSHTIPVITFLLREVGVDSIFDLRQALRRRP-RLLACSVDHQLRPTLYFLQRI 191

  Fly   108 LHLLLTKYPELLDVSDSHQLLSHIGFLQSRVSTSKNVWKCLMNSPDLIAQS-EVSIEEKLNFITD 171
            ..|...|:..||..|..::|:..|.:.:....:.::........|.|...| ..:.|.||.::..
plant   192 GILDPHKHTYLLSCSVDNKLVPRIDYFEKLGFSRRSATAMFKRFPQLFNYSIAENYEPKLKYLMV 256

  Fly   172 VMRIEVPELVK-SAALTLSFE-ELRCRHQFLLRLGLFKPRPPKADPNEPTTNPKLYQITDTS 231
            .|..:|.|::: ....:.|.| .::.||:.....|:..|.|.....||......|....|:|
plant   257 EMGRDVREVLEFPQYFSFSLENRIKPRHEACAAKGVRFPLPVMLKTNEAGFRDTLEVCCDSS 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15390NP_608676.2 mTERF <75..205 CDD:303004 27/141 (19%)
EMB3114NP_850257.1 mTERF <125..307 CDD:303004 37/182 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13068
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.