DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15390 and EMB2219

DIOPT Version :8

Sequence 1:NP_608676.2 Gene:CG15390 / 33422 FlyBaseID:FBgn0031419 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_179763.3 Gene:EMB2219 / 816708 AraportID:AT2G21710 Length:641 Species:Arabidopsis thaliana

Alignment Length:262 Identity:54/263 (21%)
Similarity:96/263 (37%) Gaps:74/263 (28%)


  Fly    54 EIWRRAHQTFQNHGLETVNFLRIVTGNPAILKRTPDKIISCLEIWRAC--------QFG--ENLL 108
            |.|:...:.|...|:......||:...|         |:.|:::.:..        :.|  ...:
plant   386 ERWKPLVKYFYYLGIPKEGMKRILVVKP---------ILYCIDLEKTIAPKVRFLQEMGIPNEAI 441

  Fly   109 HLLLTKYPELLDVSDSHQLLSHIGFLQSRVS-TSKNVWKCLMNSPDLIAQSEVSIEEKLN----- 167
            ..:|.|:|.||..|...::...:.||.:|.. |.|::.|.:...|.|:.   .||..||.     
plant   442 GNMLVKFPSLLTNSLYKKIRPVVIFLLTRAGVTQKDIGKVIAMDPALLG---CSIGTKLEPNMRY 503

  Fly   168 FITDVMRI-EVPELVKSAALTLSF--EELRCRHQFLLRLGLFKPR-------------------P 210
            :|:..:|. ::.|::....:.|.:  :.||.::::|.|. :.:|.                   |
plant   504 YISLGIRFYQLGEMIADFPMLLRYNVDNLRPKYRYLRRT-MIRPLQDLIEFPRFFSYSLERRIIP 567

  Fly   211 PKADPNEPTTNPKL-YQITDTSEKSFATKICHVTLPEYEAFKDLYAKELEQKSRRKEEDE--LSD 272
            ......|...|.|| |.:..|.|             |:|       :.:..|..|:|..|  |..
plant   568 RHTIMVENRVNFKLRYMLACTDE-------------EFE-------RRVRDKVERRERFEAGLDS 612

  Fly   273 ED 274
            ||
plant   613 ED 614

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15390NP_608676.2 mTERF <75..205 CDD:303004 32/149 (21%)
EMB2219NP_179763.3 mTERF 285..593 CDD:303004 46/233 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13068
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.