DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15390 and Mterf4

DIOPT Version :9

Sequence 1:NP_608676.2 Gene:CG15390 / 33422 FlyBaseID:FBgn0031419 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001032286.1 Gene:Mterf4 / 363289 RGDID:1562440 Length:347 Species:Rattus norvegicus

Alignment Length:287 Identity:62/287 - (21%)
Similarity:124/287 - (43%) Gaps:38/287 - (13%)


  Fly     6 LFNTQAVLKQQSNLHHIRHLATPKILQLEQIHIDEAIKIEPTLAVFSPEIWRRAHQTFQNHGLET 70
            |...|.......:|...|.:::.:.:...:.|||..:.|:|::   .|:           ..|:.
  Rat    77 LHEEQRTCMGSESLELERAISSLQDMGFAEAHIDSLLNIQPSV---HPQ-----------QLLDI 127

  Fly    71 VNFLRIVTGNP----AILKRTPDKI-ISCLEIWRACQF------GENLLHLLLTKYPELL----- 119
            ::.|.::..||    ..||:.|..: :|..::.|...:      ||..|..:|:..|::.     
  Rat   128 ISELLLLGLNPEPVFMALKKNPQLLKLSATQMKRRSSYLRKLGLGEGKLKRVLSVCPKVFTMRQQ 192

  Fly   120 DVSDSHQLLSHIGFLQSRVSTSKNVWKCLMNSPDLIAQSEVSIEEKLNFITDVMRIEVPELVKSA 184
            |:.:..::|.     :..:.|.:::...|...|.::.:....:|.|..:....|.:...::|::.
  Rat   193 DIDNIVKVLK-----EKCLFTVQHITDILHRCPAVLQEDPSELEYKFQYAYFRMGLTHLDIVRTD 252

  Fly   185 ALTLSFEELRCRHQFLLRLGLFKPRPPKADPNEPTTNPKLYQITDTSEKSFATKICHVTLPEYEA 249
            .|..|..:::.||.:|.|||.::....|.....|  ||.|..|...||..|..:....:..|:|.
  Rat   253 FLQYSIAKVKQRHIYLERLGRYQTPDKKGQTQIP--NPSLKNILRVSEAEFLARTACSSAEEFEV 315

  Fly   250 FKDLYAKELEQ-KSRRKEEDELSDEDD 275
            ||.|..:|.|: :|...||:|..:|::
  Rat   316 FKKLLDQEEEESESHMSEEEEEEEEEE 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15390NP_608676.2 mTERF <75..205 CDD:303004 28/145 (19%)
Mterf4NP_001032286.1 MTERF 1 142..172 5/29 (17%)
MTERF 2 177..204 4/31 (13%)
MTERF 3 209..239 4/29 (14%)
MTERF 4 245..270 6/24 (25%)
MTERF 5 290..318 8/27 (30%)
Dimerization with NSUN4. /evidence=ECO:0000250 310..327 7/16 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..347 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354339
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29YX2
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431133at2759
OrthoFinder 1 1.000 - - FOG0006444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109637
Panther 1 1.100 - - O PTHR13068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5409
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.