DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15390 and K11D2.5

DIOPT Version :8

Sequence 1:NP_608676.2 Gene:CG15390 / 33422 FlyBaseID:FBgn0031419 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001021568.2 Gene:K11D2.5 / 3565891 WormBaseID:WBGene00010771 Length:348 Species:Caenorhabditis elegans

Alignment Length:245 Identity:67/246 (27%)
Similarity:107/246 (43%) Gaps:43/246 (17%)


  Fly    30 ILQLEQIHIDEAIKIEPTLAVFSPEIWRRAHQTFQNHGLETVNFLRIVTGNPAILKRTPDKIISC 94
            |:.:..:..::||::   ||:|..::.|.                    |:|:|.|.        
 Worm   109 IVNVGYVTFEDAIRL---LALFPDDLLRH--------------------GSPSITKN-------- 142

  Fly    95 LEIWRACQFG-ENLLHLLLTKYPELLDVSDSHQL--LSH-IGFLQSRVSTSKNVWKCLMNSPDLI 155
            :|...||... ...:...:.|.|.||...|..::  |:| ||...||......:.:|    |.::
 Worm   143 IEALSACGISTPRTIGSAIKKCPPLLFARDPQEMQRLAHEIGGFFSRKQAGHLISRC----PQIL 203

  Fly   156 AQSEVSIEEKLNFITDVMRIEVPELVKSAAL--TLSFEELRCRHQFLLRLGLFKPRPPKADPNEP 218
            .:....||||..::...|.:|..::.:....  .|:|:|:..||:|||..|.| ..|....|...
 Worm   204 LKPIEEIEEKYEYMFYQMGVEADDVAECIGWIDILTFDEIVDRHKFLLATGKF-ATPDAKRPQIR 267

  Fly   219 TTNPKLYQITDTSEKSFATKICHVTLPEYEAFKDLYAKE-LEQKSRRKEE 267
            ..||||..|.|:.|:.||.|:..||:.|:..||.|..|| :.:|..||.|
 Worm   268 IENPKLQSILDSKEEDFAVKVARVTMEEWIVFKALRVKETINEKKERKFE 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15390NP_608676.2 mTERF <75..205 CDD:303004 35/136 (26%)
K11D2.5NP_001021568.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C213273781
eggNOG 1 0.900 E1_29YX2
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I3878
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006239
OrthoInspector 1 1.000 T477460
orthoMCL 1 0.900 OOG5_135943
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.875 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4039
TreeFam 1 0.960
98.680

Return to query results.
Submit another query.