DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15390 and mterf4

DIOPT Version :8

Sequence 1:NP_608676.2 Gene:CG15390 / 33422 FlyBaseID:FBgn0031419 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_002933402.1 Gene:mterf4 / 100379954 XenbaseID:XB-GENE-950854 Length:322 Species:Xenopus tropicalis

Alignment Length:209 Identity:56/209 - (26%)
Similarity:95/209 - (45%) Gaps:2/209 - (0%)


  Fly    67 GLETVNFLRIVTGNPAILKRTPDKIISCLEIWRACQFGENLLHLLLTKYPELLDVSDSHQLLSHI 131
            ||:....|:::..:..:.|.|..::....|..|:...||..|...|::.|.||.:..||.|.:..
 Frog    70 GLKPQAALKMLEDSKELRKATVRELRDRTENLRSLGLGEGFLQRSLSRCPALLSLPRSHVLAAAK 134

  Fly   132 GFLQSRVSTSKNVWKCLMNSPDLIAQSEVSIEEKLNFITDVMRIEVPELVKSAALTLSFEELRCR 196
            ...|....::..:...|..||:.:......:||...::...|.....:::.|.....|.:|:|.|
 Frog   135 CLRQRCQFSALQLTDILRFSPEALTYDPSYLEEAFQYVYFRMGASHKDIITSGLFQTSLDEIRVR 199

  Fly   197 HQFLLRLGLFKPRPPKADPNEPTTNPKLYQITDTSEKSFATKICHVTLPEYEAFKDLYAKELEQK 261
            ||||.|||.|  .||......|.:||||.::|..|:..|...:..|:..|...|:.::|:|..:.
 Frog   200 HQFLERLGRF--LPPDKKGVSPPSNPKLKEVTALSDSDFLAHVARVSPEELHTFRKIFAREELEA 262

  Fly   262 SRRKEEDELSDEDD 275
            ..||:.:...|..|
 Frog   263 GERKDSEAGRDHLD 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15390NP_608676.2 mTERF <75..205 CDD:303004 32/129 (25%)
mterf4XP_002933402.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1431133at2759
OrthoFinder 1 1.000 FOG0006239
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.