DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3609 and si:ch211-276f18.2

Sequence 1:NP_001188684.1 Gene:CG3609 FlyBaseID:FBgn0031418 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_009295943.1 Gene:si:ch211-276f18.2 ZFINID:ZDB-GENE-091118-89 Length:391 Species:Danio rerio

Alignment Length:356 Identity:83/357 (23%)
Similarity:141/357 (39%) Gaps:70/357 (20%)


  Fly    21 IALSTLPSSDHKVQAVAARALDRAQEFATKHGIPKALGSYEELAKSTDVDVVYIGTLNPQHYEVA 85
            :.:..|......|:|:..|..:.|:|.|....:|......:::....|||:|.|....|...::|
Zfish    16 VIIPLLKGEGFSVKALWGRTQEEAEELARDMNVPFYTNRIDDVLLHPDVDLVCINLPPPLTRQIA 80

  Fly    86 LLMLNNGKHVLCEK---PL----AMNKKQVEGILAAAKANKRFFMEAVWSRFFPSYQRVKELISS 143
            :..|..||:|:|::   ||    .|:..|....|.:...|.        .||.|::.|:|||:..
Zfish    81 VKTLGIGKNVICDRTATPLDAFRMMSAAQYYPKLLSIMGNV--------LRFLPAFVRMKELLEE 137

  Fly   144 GQLGQ--VKDVEVNFGFPMPHVDRLQKRE-------LGGGVVYDLGIYTIQVSQWAFQEKPEKIE 199
            |.:|:  |.:.:|:.|      ..|.|:.       :|||.::.:|.|.|.:..:....:..|:.
Zfish   138 GYIGELMVCEAQVHSG------SLLGKKYNWSCDDLMGGGGLHSVGSYIIDLLTFLTGRRAAKVH 196

  Fly   200 S------KGTLNAEGI-----DDDVSATLTYSGGR--TARMRFSSKEKLGNTAVIKGTKGQVTL- 250
            .      |.|.:..||     ||..:..:...||.  |..:.|:...:.....|:.||.|::.: 
Zfish   197 GFLKTFVKQTDHIRGIRQITSDDFCTFQMVLEGGACCTVTLNFNVPGEFRQEVVVVGTAGRLKVC 261

  Fly   251 -IDFWSPNKLIDIDGQEKEWLPPKGKYATNYAN--SEAMR-----------YEAEAVRQSI---- 297
             .|.:....    ||:..:.|..|.|.|...|:  .:|.|           ...:||||:.    
Zfish   262 GTDLYGQKN----DGECGQELLLKDKTAIGNASLPDKAFRDIPSPYLTGTICMVQAVRQAFQDQD 322

  Fly   298 ----IAGEVENKNVTYADSLIFAEIEDTIRK 324
                ..|.......|:.|.|....:.|||:|
Zfish   323 DRRTWDGRPLTMAATFEDCLYALCVVDTIKK 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3609NP_001188684.1 MviM 5..292 CDD:223745 71/315 (23%)
GFO_IDH_MocA 5..123 CDD:279716 26/109 (24%)
GFO_IDH_MocA_C 138..>198 CDD:304482 17/69 (25%)
si:ch211-276f18.2XP_009295943.1 MviM 5..>260 CDD:223745 61/258 (24%)
GFO_IDH_MocA 5..117 CDD:279716 25/101 (25%)
GFO_IDH_MocA_C 132..>195 CDD:304482 17/69 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1924
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.