DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3609 and zgc:101723

Sequence 1:NP_001188684.1 Gene:CG3609 FlyBaseID:FBgn0031418 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001005600.1 Gene:zgc:101723 ZFINID:ZDB-GENE-040927-25 Length:334 Species:Danio rerio

Alignment Length:333 Identity:152/334 (46%)
Similarity:214/334 (64%) Gaps:3/334 (1%)


  Fly     5 IRWGIASAGKISEDFVIALSTLPSSDHKVQAVAARALDRAQEFATKHGIPKALGSYEELAKSTDV 69
            :||||.||||||.||.:||.||.:..|:|.|||||.|..|||||.||.||:|.|||||||:..::
Zfish     3 LRWGICSAGKISHDFTVALRTLQAEQHQVVAVAARELAHAQEFAQKHSIPRAYGSYEELAEDPEI 67

  Fly    70 DVVYIGTLNPQHYEVALLMLNNGKHVLCEKPLAMNKKQVEGILAAAKANKRFFMEAVWSRFFPSY 134
            ||||:||::|.|..|.||.:|..|:||||||||||.|:|:.:::||:.:..|.|||||:||||:.
Zfish    68 DVVYVGTIHPHHLRVGLLFMNAKKNVLCEKPLAMNLKEVQQMISAARRSDVFLMEAVWTRFFPAS 132

  Fly   135 QRVKELISSGQLGQVKDVEVNFGFPMPHVDRLQKRELGGGVVYDLGIYTIQVSQWAFQ-EKPEKI 198
            ..:..|:|...:||||.|..:||..:..|.|..::.||||.:.|:|||.||.....|. ||||:|
Zfish   133 LEISRLLSQNAVGQVKLVRADFGAALLGVPRAVQKHLGGGALLDIGIYCIQFVLMVFNGEKPEQI 197

  Fly   199 ESKGTLNAEGIDDDVSATLTYSGGRTARMRFSSKEKLGNTAVIKGTKGQVTL-IDFWSPNKLIDI 262
            ::.|.....|:|:.:..||.:||.|.|....:...:|.|.|:|.||:..:.: ...|.|..|: :
Zfish   198 QASGVCLDTGVDEAMVVTLKFSGHRLAVCTCTVAAELPNEALIVGTEATIKVPAHMWCPTTLL-V 261

  Fly   263 DGQEKEWLPPKGKYATNYANSEAMRYEAEAVRQSIIAGEVENKNVTYADSLIFAEIEDTIRKQIG 327
            :|.|.::..|......|:.||..||||||.||:.::||..|:..:::|||.:.|:|.|..|:|:|
Zfish   262 NGVETQFPVPDPHLPLNFINSTGMRYEAEEVRRCVLAGLKESSRMSHADSALLADIMDEARRQVG 326

  Fly   328 VLNKYDEQ 335
            |:...|.|
Zfish   327 VVYSQDSQ 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3609NP_001188684.1 MviM 5..292 CDD:223745 135/289 (47%)
GFO_IDH_MocA 5..123 CDD:279716 69/118 (58%)
GFO_IDH_MocA_C 138..>198 CDD:304482 26/61 (43%)
zgc:101723NP_001005600.1 MviM 1..326 CDD:223745 148/324 (46%)
GFO_IDH_MocA 3..121 CDD:279716 69/118 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 1 1.000
Homologene 1 1.000 H8709
Inparanoid 1 1.050 294 1.000 Inparanoid score I2697
OMA 1 1.010
OrthoDB 1 1.010 D351032at33208
OrthoFinder 1 1.000 FOG0001785
OrthoInspector 1 1.000 T597671
orthoMCL 1 0.900 OOG5_128107
Panther 1 1.100 LDO PTHR22604
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1924
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.