DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3609 and CG17712

Sequence 1:NP_001188684.1 Gene:CG3609 FlyBaseID:FBgn0031418 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_608619.1 Gene:CG17712 FlyBaseID:FBgn0027597 Length:384 Species:Drosophila melanogaster

Alignment Length:368 Identity:79/369 (21%)
Similarity:151/369 (41%) Gaps:72/369 (20%)


  Fly     8 GIASAGKISEDFVIALSTLPSSDHKVQAVAARALDRAQEFATKHGIPKALGSYEELAKSTDVDVV 72
            |:...|:|:.   :.:..|.....:|:|:..|.|..|:|.||...:.......:::....|||:|
  Fly     6 GVFGTGEIAN---VLVPLLREKGFEVRAIWGRTLKEAKETATTQNVQFHTNVIDDVLLRKDVDLV 67

  Fly    73 YIGTLNPQHYEVALLMLNNGKHVLCEKPLAMNKKQVEGILAAAKANKRFFMEAVWS------RFF 131
            :|......|.|:::..|..||||:|:||..::::....::.|::     :...:.|      ||.
  Fly    68 FIVCQPFLHAEISVKALGIGKHVVCDKPAGLHQQDALKMVRASQ-----YYPTLISLVNHPLRFL 127

  Fly   132 PSYQRVK-----ELISSGQLGQV--KDVEVNFG--FPMPHVDRLQKRELGGGVVYDLGIYTIQVS 187
            |::..::     |||  |.:|.|  .||.|..|  ||..: :.:...::|||.:..:| ..:.:.
  Fly   128 PAFTHMRRCLQEELI--GSIGDVVLMDVRVQMGTLFPEKY-NWMCDAQMGGGALNLVG-SVVDLV 188

  Fly   188 QWAFQEKPEKIE------SKGTLNAEGI-----DDDVSATLTYSGGRTARMRFSS----KEKLGN 237
            .:..|::..::.      :|.|....||     .|..:..:..:.|....:...|    .:....
  Fly   189 TFLLQQQAIRVHGVLRSYTKTTPAINGIRQITAPDFCNFQMELASGTLVTVALHSHTVPAKAFSQ 253

  Fly   238 TAVIKGTKGQV--------TLIDFWSPNKLIDIDGQEKEWLPPKGKYATNYANSEAMRYEAEAVR 294
            ..:|.|:||.:        .|.:.....:.:.:|.|:..       :|||  ||...|...:.:.
  Fly   254 EVLIYGSKGHLVVRGGDLFVLKEGQPKEEAVYVDVQDLH-------FATN--NSLLPRPYIKGLC 309

  Fly   295 QSIIA-----GEVENKNV--------TYADSLIFAEIEDTIRK 324
            :.:.|     |..|:..|        |:.|.|....:.:.|||
  Fly   310 KMVGALKEAFGSKESSWVKAPVSTAATFEDGLYVQAVVEAIRK 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3609NP_001188684.1 MviM 5..292 CDD:223745 69/322 (21%)
GFO_IDH_MocA 5..123 CDD:279716 28/115 (24%)
GFO_IDH_MocA_C 138..>198 CDD:304482 17/69 (25%)
CG17712NP_608619.1 MviM 5..364 CDD:223745 79/369 (21%)
GFO_IDH_MocA 5..109 CDD:279716 27/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112817423
eggNOG 1 0.900 E1_COG0673
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1924
32.860

Return to query results.
Submit another query.