DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3609 and Gfod1

Sequence 1:NP_001188684.1 Gene:CG3609 FlyBaseID:FBgn0031418 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001028571.1 Gene:Gfod1 MGIID:2145304 Length:390 Species:Mus musculus

Alignment Length:359 Identity:81/360 (23%)
Similarity:147/360 (41%) Gaps:77/360 (21%)


  Fly    21 IALSTLPSSDHKVQAVAARALDRAQEFATKHGIPKALGSYEELAKSTDVDVVYIGTLNPQHYEVA 85
            :.:..|......|:|:..|..:.|:|.|.:..:|......:|:....|||:|.|....|...::|
Mouse    16 VIIPLLKDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCINLPPPLTRQIA 80

  Fly    86 LLMLNNGKHVLCEK---PLAMNKKQVEGILAAAKANKRFFMEAVWS--RFFPSYQRVKELISSGQ 145
            :..|..||:|:|::   ||...:     :::||....: .|..:.:  ||.|::.|:|:||..|.
Mouse    81 VKTLGIGKNVICDRTATPLDAFR-----MMSAAHYYPK-LMSIMGNVLRFLPAFVRMKQLIEEGY 139

  Fly   146 LGQ--VKDVEVNFGFPMPHVDRLQKRE-------LGGGVVYDLGIYTIQVSQWAFQEKPEKIES- 200
            :|:  |.:|:|:.|      ..|.|:.       :|||.::.:|.|.|.:..:...:|..|:.. 
Mouse   140 VGELLVCEVQVHSG------SLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGL 198

  Fly   201 -----KGTLNAEGI-----DDDVSATLTYSGG--RTARMRFSSKEKLGNTAVIKGTKGQVTLIDF 253
                 |.|.:.:||     ||..:..:...||  .|..:.|:...:......:.|:.|::..:. 
Mouse   199 LKTFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVG- 262

  Fly   254 WSPNKLIDIDGQ-----EKEWLPPKGKYATNYANS---------------EAMRYEAEAVRQSI- 297
                  .|:.||     |:|.|.   :..|:.:||               .......:||||:. 
Mouse   263 ------TDLYGQRNSAPEQELLL---QDTTSVSNSLLPEKAFSDIPSPYLRGTMKMMQAVRQAFQ 318

  Fly   298 -------IAGEVENKNVTYADSLIFAEIEDTIRK 324
                   ..|.......|:.|.|....:.|||::
Mouse   319 DQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKR 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3609NP_001188684.1 MviM 5..292 CDD:223745 70/318 (22%)
GFO_IDH_MocA 5..123 CDD:279716 25/105 (24%)
GFO_IDH_MocA_C 138..>198 CDD:304482 19/69 (28%)
Gfod1NP_001028571.1 MviM 5..363 CDD:223745 81/360 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1924
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.