DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3609 and Gfod2

Sequence 1:NP_001188684.1 Gene:CG3609 FlyBaseID:FBgn0031418 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001100891.1 Gene:Gfod2 RGDID:1311198 Length:385 Species:Rattus norvegicus

Alignment Length:367 Identity:74/368 (20%)
Similarity:143/368 (39%) Gaps:71/368 (19%)


  Fly     8 GIASAGKISEDFVIALSTLPSSDHKVQAVAARALDRAQEFATKHGIPKALGSYEELAKSTDVDVV 72
            |:...|..:.   :.:..|.:....|:|:..:..:.|::.|.:..|.......:::....|||:|
  Rat     8 GVFGTGSSAR---VLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNITFYTSRTDDVLLHQDVDLV 69

  Fly    73 YIGTLNPQHYEVALLMLNNGKHVLCEKPLAMNKKQVEGILAAAKANKRFF---MEAVWS--RFFP 132
            .|....|...::::..|..||:|:|||  |........::.|:    |::   |..|.:  ||.|
  Rat    70 CINIPPPLTRQISVKALGIGKNVVCEK--AATSVDAFRMVTAS----RYYPQLMSLVGNVLRFLP 128

  Fly   133 SYQRVKELISSGQLGQVK--DVEVNFGFPMPH-----VDRLQKRELGGGVVYDLGIYTIQVSQWA 190
            ::.|:|:||:...:|.|.  |..:..|..:..     .|.|    :|||.::.:|.|.:.:....
  Rat   129 AFVRMKQLIAEHYVGAVMICDARIYSGSLLSSSYGWICDEL----MGGGGLHTMGTYIVDLLTHL 189

  Fly   191 FQEKPEKIES------KGTLNAEGI-----DDDVSATLTYSGG--RTARMRFSSKEKLGNTAVIK 242
            ..:|.||:..      :......||     ||.....:...||  .|..:.|:......:..::.
  Rat   190 TGQKAEKVHGLLKTFVRQNATIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVV 254

  Fly   243 GTKGQVTLIDFWSPNKLIDIDGQEKE----------------WLPPKGKYATNYANSEAMRYEAE 291
            |:.|::..       :..|:.||:..                .||.:|.........:.|.|..:
  Rat   255 GSAGRLVA-------RGADLYGQKNSAAQEELLVRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQ 312

  Fly   292 AVRQSIIAGEVENKN---------VTYADSLIFAEIEDTIRK 324
            |:||| ..|:.:.:.         .::.|.|....:.|.|::
  Rat   313 ALRQS-FQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKR 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3609NP_001188684.1 MviM 5..292 CDD:223745 65/325 (20%)
GFO_IDH_MocA 5..123 CDD:279716 24/118 (20%)
GFO_IDH_MocA_C 138..>198 CDD:304482 17/67 (25%)
Gfod2NP_001100891.1 MviM 7..365 CDD:223745 74/368 (20%)
GFO_IDH_MocA 7..111 CDD:279716 23/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.