DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3609 and DHDH

Sequence 1:NP_001188684.1 Gene:CG3609 FlyBaseID:FBgn0031418 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_055290.1 Gene:DHDH HGNCID:17887 Length:334 Species:Homo sapiens

Alignment Length:334 Identity:143/335 (43%)
Similarity:199/335 (59%) Gaps:5/335 (1%)


  Fly     5 IRWGIASAGKISEDFVIALSTLPSSDHKVQAVAARALDRAQEFATKHGIPKALGSYEELAKSTDV 69
            :||||.|.|.||.||...|.|||.|:|:|.|||||.|.||:|||.||.||||.||||||||...|
Human     3 LRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSV 67

  Fly    70 DVVYIGTLNPQHYEVALLMLNNGKHVLCEKPLAMNKKQVEGILAAAKANKRFFMEAVWSRFFPSY 134
            :|.||||.:|||....:|.|..||.||||||..:|..:|..::|.|::...|.|||:|:||||:.
Human    68 EVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPAS 132

  Fly   135 QRVKELISSGQLGQVKDVEVNFGFPMPHVDRLQKRELGGGVVYDLGIYTIQVSQWAF-QEKPEKI 198
            :.::.:::.|.||.::.....||..:.||.|...|...||.:.|:|||.:|.:...| .:|||||
Human   133 EALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKI 197

  Fly   199 ESKGTLNAEGIDDDVSATLTYSGGRTARMRFSSKEKLGNTAVIKGTKGQVTLID-FWSPNKLIDI 262
            ...|..:..|:||.|:..|.|.|........|...:|.|||.:.||||.|.|:: .|.|.:|: :
Human   198 SVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELV-V 261

  Fly   263 DGQEKEW-LPPKGKYATNYANSEAMRYEAEAVRQSIIAGEVENKNVTYADSLIFAEIEDTIRKQI 326
            .|:.||: |||..| ..|:.|...|.|||:.|.:.:..|..|:..:..::|.:.|:|.:.:||.|
Human   262 KGEHKEFPLPPVPK-DCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAI 325

  Fly   327 GVLNKYDEQ 335
            ||....|::
Human   326 GVTFPQDKR 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3609NP_001188684.1 MviM 5..292 CDD:223745 131/290 (45%)
GFO_IDH_MocA 5..123 CDD:279716 66/118 (56%)
GFO_IDH_MocA_C 138..>198 CDD:304482 21/61 (34%)
DHDHNP_055290.1 MviM 1..326 CDD:223745 140/325 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 1 1.000
Homologene 1 1.000 H8709
Inparanoid 1 1.050 255 1.000 Inparanoid score I3126
Isobase 1 0.950 0 Normalized mean entropy S4313
OMA 1 1.010
OrthoDB 1 1.010 D351032at33208
OrthoFinder 1 1.000 FOG0001785
OrthoInspector 1 1.000 T1074651
orthoMCL 1 0.900 OOG5_128107
Panther 1 1.100 LDO PTHR22604
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.