DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3609 and Blvra

Sequence 1:NP_001188684.1 Gene:CG3609 FlyBaseID:FBgn0031418 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_446302.1 Gene:Blvra RGDID:620721 Length:295 Species:Rattus norvegicus

Alignment Length:283 Identity:57/284 (20%)
Similarity:91/284 (32%) Gaps:104/284 (37%)


  Fly    59 SYEELAKSTDVDVVYIGTLNPQHYEVALLMLNNGKHVLCEKPLAMNKKQVEGILAAAKANKRFFM 123
            |.|:..:|.::||.||.:.:..|.:.....|..|||||.|.|:.::                   
  Rat    57 SLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLS------------------- 102

  Fly   124 EAVWSRFFPSYQRVKELISSGQLGQVKDVEVNFGFPMPHVDRLQ------KRELGGGVVYDLGIY 182
                   |.:.|.:.||  :.|.|:|...|        ||:.|.      :||:.|         
  Rat   103 -------FAAAQELWEL--AAQKGRVLHEE--------HVELLMEEFEFLRREVLG--------- 141

  Fly   183 TIQVSQWAFQEKPEKIESKGTLNAEGIDDDVSATLTYSGGRTARMRFSSKEKLGNTAVIKGTKGQ 247
                          |...||:|.           .|.|.....|..|.:...:.....:....|:
  Rat   142 --------------KELLKGSLR-----------FTASPLEEERFGFPAFSGISRLTWLVSLFGE 181

  Fly   248 VTLIDFWSPNK--------LIDIDGQEK---EWLPPKGKYATNYANSEAMRYEAEAVRQSIIAGE 301
            ::||......:        .:.::.|.|   .|:..||      ...:..||    |.....:|.
  Rat   182 LSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKG------PGLKRNRY----VNFQFTSGS 236

  Fly   302 VE-------NKNVTYADSLIFAE 317
            :|       |||:...|..||.:
  Rat   237 LEEVPSVGVNKNIFLKDQDIFVQ 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3609NP_001188684.1 MviM 5..292 CDD:223745 48/250 (19%)
GFO_IDH_MocA 5..123 CDD:279716 16/64 (25%)
GFO_IDH_MocA_C 138..>198 CDD:304482 13/66 (20%)
BlvraNP_446302.1 GFO_IDH_MocA 18..124 CDD:279716 24/103 (23%)
MviM 57..>139 CDD:223745 29/118 (25%)
Biliv-reduc_cat 132..242 CDD:286275 24/154 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.