DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3597 and AT1G34200

Sequence 1:NP_001259930.1 Gene:CG3597 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_564441.1 Gene:AT1G34200 AraportID:AT1G34200 Length:352 Species:Arabidopsis thaliana

Alignment Length:237 Identity:60/238 (25%)
Similarity:104/238 (44%) Gaps:16/238 (7%)


  Fly    35 VVAVADVDG-QRAQQFAQRNQIP---RHYDGFDALALDREVEVVYVGTLNPFHYAVVHLMLARGK 95
            :.|:|.... :.|:.||:.|..|   :.:..:::|..|.:|:.||.......|.....|...:||
plant    33 ISAIATTSSIEEAKSFAKSNNFPPNTKLHSSYESLLEDPDVDAVYFPIPTRLHVEWATLAAIKGK 97

  Fly    96 NVLCETPMCLSVEQAKELYTLAEQRGVFLMEGNSMWSRFFPSYDRLRELLKNDV--IGEVTQVKV 158
            ::|.:.|:.|:|.:..::....|..||..|:| :.|.. .|..|:::|.: ||:  .|::..|..
plant    98 HILLDKPVALNVAEFDQIVEACEVNGVQFMDG-TQWMH-SPRTDKIKEFV-NDLESFGQIKSVYS 159

  Fly   159 QHGFR-----LAHMERVCNRSLGGSILMDIGIYALQLGQFV--FGVSPVKILPSGTQLNKERVDV 216
            ...|.     |.|..||.....|...|.|.|.|.:|....|  |.:.......||:.||...:.:
plant   160 CFSFAASDDFLKHDIRVKPGLDGLGALGDAGWYTIQAILLVNNFKLPKTVTALSGSVLNDAGIVL 224

  Fly   217 QIDFMLDYGDGRRLVALVTGLENLENDAVITGTKGEIKLSNY 258
            ....:.|:.||.......:.|.||..:....||||.:::.::
plant   225 SCGALFDWEDGVNATIYCSFLANLTMEITAIGTKGSLRVHDF 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 60/238 (25%)
GFO_IDH_MocA 7..127 CDD:279716 24/96 (25%)
GFO_IDH_MocA_C 142..228 CDD:304482 25/95 (26%)
AT1G34200NP_564441.1 MviM 6..342 CDD:223745 60/238 (25%)
GFO_IDH_MocA 7..127 CDD:279716 23/94 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I2115
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D943656at2759
OrthoInspector 1 1.000 T32103
orthoMCL 1 0.900 OOG5_128107
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.