DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3597 and gfod2

Sequence 1:NP_001259930.1 Gene:CG3597 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001071214.2 Gene:gfod2 ZFINID:ZDB-GENE-061103-64 Length:367 Species:Danio rerio

Alignment Length:296 Identity:69/297 (23%)
Similarity:104/297 (35%) Gaps:70/297 (24%)


  Fly    10 GIAAAGRITQDFVTALGTVEKSRHVVVAVADVDGQRAQQFAQRNQIPRHYDGFDALALDREVEVV 74
            |:...|:..:..|..|   :|....|.||.....:.|:..|....||......|.:.|..||.:|
Zfish     6 GVFGTGQTVRALVPLL---QKEGFPVQAVWGRTQEEAESLASELDIPFSTSQTDDVLLHPEVHLV 67

  Fly    75 YVGTLNPFHYAVVHLMLARGKNVLCE-----TPMCLSVEQAKELYTLAEQRGVFLMEGNSMWSRF 134
            .:.|..|....:....|..||||:.|     |..|..|..|:....|..      :.|||:  ||
Zfish    68 CILTPPPHTRQIAVKALGIGKNVISEQAATLTDACKMVTAARYYPQLMS------IMGNSL--RF 124

  Fly   135 FPSYDRLRELLKNDVIG--EVTQVKVQHGFRLAH-----MERVCNRSLGGSILMDIGIYALQLGQ 192
            .|::..::.||.....|  :|.:.:|..|..|:.     .|.:    :||..|..:|...:.|..
Zfish   125 LPAFVHMKRLLGEGYCGSLQVCEARVYGGSLLSQSYGWAWEEL----MGGGGLHTVGSCIIDLLS 185

  Fly   193 FVFGVSPVKI------------------------------LPSG-------TQLNKERVDVQIDF 220
            .:.|...|::                              |.||       ...|....||. :.
Zfish   186 HLTGCRAVRVHGMLRTFVRQGGPAGGIRSVTADDYACFQLLMSGGAVCSVTLNFNLPGTDVH-EI 249

  Fly   221 MLDYGDGRRLVALVTGL----ENLENDAVITGTKGE 252
            || .|...||||..|.|    .|::.:.::....||
Zfish   250 ML-VGSSGRLVARGTELFGQRINMQAEELLLSDGGE 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 69/297 (23%)
GFO_IDH_MocA 7..127 CDD:279716 30/122 (25%)
GFO_IDH_MocA_C 142..228 CDD:304482 24/130 (18%)
gfod2NP_001071214.2 MviM 5..350 CDD:223745 69/297 (23%)
NADB_Rossmann 5..109 CDD:304358 29/106 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.