DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3597 and blvra

Sequence 1:NP_001259930.1 Gene:CG3597 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001070069.1 Gene:blvra ZFINID:ZDB-GENE-060929-312 Length:292 Species:Danio rerio

Alignment Length:173 Identity:44/174 (25%)
Similarity:72/174 (41%) Gaps:42/174 (24%)


  Fly    10 GIAAAGRITQDFVTALGTVEKSRHVVVAVADVDGQRAQQFAQRNQIPRH----YDGF------DA 64
            ||..||.:            :.|.:   :|.:....|:|.:.|..:.|.    ..|.      :|
Zfish     8 GIGIAGSV------------RMRDL---MAPLSSSAAEQISIRGFVSRRSLEDQQGVKQISMTEA 57

  Fly    65 LALDREVEVVYVGTLNPFHYAVVHLMLARGKNVLCETPMCLSVEQAKELYTLAEQRGVFLMEGNS 129
            |:.| ::.|.::.|.|..|...:...|..||:|..|.||.||...|.:|:.||:|:|:.|.|.:.
Zfish    58 LSRD-DIHVAFICTENTSHEENIRQFLEAGKHVCVEYPMTLSHTSAVDLWNLAQQKGLVLHEEHI 121

  Fly   130 MWSRFFPSYDRLRELLKNDVIGEVTQ----------VKVQHGF 162
              ..|.|.:.:    ||.|:.|:..:          :|...||
Zfish   122 --ELFTPDFKQ----LKKDISGKTLEEGKLHFTGGPLKANFGF 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 44/174 (25%)
GFO_IDH_MocA 7..127 CDD:279716 35/127 (28%)
GFO_IDH_MocA_C 142..228 CDD:304482 7/32 (22%)
blvraNP_001070069.1 MviM 1..>146 CDD:223745 41/160 (26%)
GFO_IDH_MocA 5..120 CDD:279716 35/128 (27%)
Biliv-reduc_cat 128..237 CDD:286275 7/36 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.