DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3597 and BLVRA

Sequence 1:NP_001259930.1 Gene:CG3597 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_000703.2 Gene:BLVRA HGNCID:1062 Length:296 Species:Homo sapiens

Alignment Length:303 Identity:72/304 (24%)
Similarity:112/304 (37%) Gaps:111/304 (37%)


  Fly    10 GIAAAGRI----------TQDFVTALGTVEKSRHVVVAVADVDGQRAQQFAQRNQIPRHYDGFDA 64
            |:..||.:          :..|:..:|.|.:..     :..:||  .||.:..          ||
Human    15 GVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRE-----LGSIDG--VQQISLE----------DA 62

  Fly    65 LALDREVEVVYVGTLNPFHYAVVHLMLARGKNVLCETPMCLSVEQAKELYTLAEQRGVFLMEGNS 129
            |: .:||||.|:.:.:..|...:...|..||:||.|.||.||:..|:||:.||||:|..|.|.: 
Human    63 LS-SQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEH- 125

  Fly   130 MWSRFFPSYDRLRE---LLKNDVIGEVTQVKVQHGFRLAHMERVCNRSLGGSILMDIGIYALQLG 191
                    .:.|.|   .||.:|:|:                    ..|.||:|...|  .|:..
Human   126 --------VELLMEEFAFLKKEVVGK--------------------DLLKGSLLFTAG--PLEEE 160

  Fly   192 QFVF----GVSPVKILPSGTQLNKERVDVQIDFMLDYGDGRRLVALVTGLENLENDAVITGTKGE 252
            :|.|    |:|                              ||..||:....|   ::::.|..|
Human   161 RFGFPAFSGIS------------------------------RLTWLVSLFGEL---SLVSATLEE 192

  Fly   253 IKLSNYW---CCTQISRSNAPPESW------PLPRAKF-DFHY 285
            .|...|.   .|.:..:.:  |.||      .|.|.:: .||:
Human   193 RKEDQYMKMTVCLETEKKS--PLSWIEEKGPGLKRNRYLSFHF 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 72/304 (24%)
GFO_IDH_MocA 7..127 CDD:279716 39/127 (31%)
GFO_IDH_MocA_C 142..228 CDD:304482 15/93 (16%)
BLVRANP_000703.2 GFO_IDH_MocA 18..125 CDD:279716 38/125 (30%)
Biliv-reduc_cat 133..242 CDD:312620 31/159 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S8218
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.