DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3597 and gfod2

Sequence 1:NP_001259930.1 Gene:CG3597 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001025591.1 Gene:gfod2 XenbaseID:XB-GENE-5740207 Length:384 Species:Xenopus tropicalis

Alignment Length:365 Identity:81/366 (22%)
Similarity:149/366 (41%) Gaps:75/366 (20%)


  Fly    22 VTALGTVEKSRHVVVAVADVDG-----------QRAQQFAQRNQIPRHYDGFDALALDREVEVVY 75
            :...||...:| |::::...||           :.|::.|:...||.:....|.:.|.:||::|.
 Frog     7 IGVFGTGNTAR-VLISLLRADGFSIEALWGKTDEEAKELAEEMGIPFYTCHTDDVLLHQEVDLVC 70

  Fly    76 VGTLNPFHYAVVHLMLARGKNVLCETPMCLSVEQAKELYTLAEQRGVF--LME--GNSMWSRFFP 136
            :....|....:....|..||||:||     ....:.:.:|:.:....:  ||.  ||::  ||.|
 Frog    71 ISIPPPLTRQIAVKALGIGKNVICE-----KAASSIDAFTMVKAARYYPKLMSLVGNAL--RFLP 128

  Fly   137 SYDRLREL-LKNDVIGE--VTQVKVQHGFRL-AHMERVCNRSLGGSILMDIGIYALQL------- 190
            ::||:|:| |:.:.:||  :..|:|..|..| ::...:|:..:||..|..:|.|.:.|       
 Frog   129 AFDRMRQLILEQNYVGEIRICDVRVYGGSLLSSNYSWICDDLMGGGGLHTLGTYLVDLLTHLTNK 193

  Fly   191 -GQFVFG-----------VSPVKILPSG----------------TQLNKERVDVQIDFMLDYGDG 227
             .:.|.|           :|.::.:.|.                ..||.......:..::..|..
 Frog   194 RAEKVHGFLKTFVKQNEAISGIRYVTSDDFCFFQMQMTGGACSTVTLNFNMPGTFVHEVMVVGSA 258

  Fly   228 RRLVALVTGLENLENDAVITGTKGEIKLSNYWCCTQISRSNAPP---ESWPLPRAKFDFHYTNTC 289
            .|||...|.|...:|.|    ::.::.||:     .::|..|..   |..|.|......|.....
 Frog   259 GRLVVRGTELFGQKNSA----SEEKLLLSD-----PLTREIADISDFEKVPPPYLMGIAHMVKAL 314

  Fly   290 GLRYEAEEVRRCIEKRLLESPKFTHAESLELAAIADEIRR 329
            ...::.:|.||..:::.| |...|..:.|.:..:.|.|:|
 Frog   315 RQSFQDQEDRRTWDQKPL-SVAATFEDGLYMQRVVDAIKR 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 81/366 (22%)
GFO_IDH_MocA 7..127 CDD:279716 26/120 (22%)
GFO_IDH_MocA_C 142..228 CDD:304482 23/125 (18%)
gfod2NP_001025591.1 MviM 1..365 CDD:223745 81/366 (22%)
GFO_IDH_MocA 7..118 CDD:279716 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.