DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3597 and gfod1

Sequence 1:NP_001259930.1 Gene:CG3597 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_012819881.1 Gene:gfod1 XenbaseID:XB-GENE-947602 Length:404 Species:Xenopus tropicalis

Alignment Length:283 Identity:63/284 (22%)
Similarity:111/284 (39%) Gaps:61/284 (21%)


  Fly    22 VTALGTVEKSRHVVVAVADVDG-----------QRAQQFAQRNQIPRHYDGFDALALDREVEVVY 75
            |...||...||.::..:.| :|           :.|::.|:...:|.:.:..|.:.|.::|::|.
 Frog     5 VGVFGTSLTSRVIIPLLKD-EGFSVKALWGRTQEEAEELAKEMSVPFYTNRIDDVLLHQDVDLVC 68

  Fly    76 VGTLNPFHYAVVHLML--------------ARGKNVLCE---TPM-CLSVEQAKELYTLAEQRGV 122
            :....|....:....|              ..||||:|:   ||: ...:..|...|.     .:
 Frog    69 INLPPPLTKQIAVKTLEGQETEDRNENGSTGIGKNVICDRTATPLDAFRMMSAAHYYP-----KL 128

  Fly   123 FLMEGNSMWSRFFPSYDRLRELLKNDVIGE--VTQVKVQHGFRLAHMER-VCNRSLGGSILMDIG 184
            ..:.||.:  ||.|::.::::|::...:||  |.:|:|..|..|..... .|:..:||..|..:|
 Frog   129 MSIMGNVL--RFLPAFVKMKQLIQEGYVGELQVCEVQVHSGSLLGKKYNWSCDDLMGGGGLHSVG 191

  Fly   185 IYALQLGQFVFGVSPVKILPSGTQLNKERVDVQIDFMLDYGDGRRLVALVTGLENLENDAVITGT 249
            .|.:.|..|:.....||:    ..|.|..|. |.|.             :.|:..:.:|...|  
 Frog   192 SYIIDLLTFLTSQKAVKV----HGLLKTFVK-QTDH-------------IKGIRQITSDDFCT-- 236

  Fly   250 KGEIKLSNYWCCTQISRSNAPPE 272
             .::.|....|||.....|.|.|
 Frog   237 -FQMVLEGGVCCTVTLNFNVPGE 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 63/284 (22%)
GFO_IDH_MocA 7..127 CDD:279716 25/134 (19%)
GFO_IDH_MocA_C 142..228 CDD:304482 23/89 (26%)
gfod1XP_012819881.1 MviM 5..376 CDD:223745 63/284 (22%)
NADB_Rossmann 5..122 CDD:304358 24/118 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1924
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.