DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3597 and CG13280

Sequence 1:NP_001259930.1 Gene:CG3597 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster

Alignment Length:331 Identity:131/332 (39%)
Similarity:176/332 (53%) Gaps:14/332 (4%)


  Fly     7 LNWGIAAAGRITQDFVTALGTVEKSRHVVVAVADVDGQRAQQFAQRNQIPRHYDGFDALALDREV 71
            |.||||....:..||..||..:.:..|.:|:........|..||:|:|:...|..|:.||....|
  Fly    92 LRWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTSFEDLAKCPNV 156

  Fly    72 EVVYVGTLNPFHYAVVHLMLARGKNVLCETPMCLSVEQAKELYTLAEQRGVFLMEGNSMWSRFFP 136
            :|||:..|||.|..:.||||...|:||||.|:|::.||..:|...|..||:|||||  ||.|..|
  Fly   157 DVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEG--MWPRCVP 219

  Fly   137 SYDRLRELLKNDVIGEVTQVKVQHGFRLAHMERVCNRSLG--GSILMDIGIYALQLGQFVFGVSP 199
            :|..||..:..:.:||:.||....|.      .|....||  |.:..|.|:|.:||..:||...|
  Fly   220 AYHYLRHQILRNRLGEIKQVHCTLGL------PVSQGRLGLYGGVTNDFGVYGMQLALWVFREVP 278

  Fly   200 VKILPSGTQLNKERVDVQIDFMLDYGDGRRLVALVTGLENLENDAVITGTKGEIKLSNYWCCTQI 264
            ..:..|| ::|.|.|||..|..|.:..|:|.:..|:..:.|.|.|||.|..|.||::||||.|::
  Fly   279 RCLKVSG-RVNSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAVIQGKDGSIKMNNYWCPTRL 342

  Fly   265 SRSNAPPESWPLPRAKF--DFHYTNTCGLRYEAEEVRRCIEKRLLESPKFTHAESLELAAIADEI 327
            .......| :|||....  ..||.|..|:.|||||||.||.|...||..|:|.|||.||.:.|.|
  Fly   343 ITEEVDYE-FPLPGGDQLPPTHYHNRLGMCYEAEEVRNCILKGSTESDDFSHNESLLLANLMDTI 406

  Fly   328 RRQIGV 333
            ..::||
  Fly   407 HAELGV 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 129/329 (39%)
GFO_IDH_MocA 7..127 CDD:279716 49/120 (41%)
GFO_IDH_MocA_C 142..228 CDD:304482 28/88 (32%)
CG13280NP_609812.1 MviM 89..387 CDD:223745 118/305 (39%)
GFO_IDH_MocA 92..213 CDD:279716 50/123 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234880313
eggNOG 1 0.900 E1_COG0673
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I2115
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D351032at33208
OrthoFinder 1 1.000 FOG0001785
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22604
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.