DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3597 and SPAC26H5.09c

Sequence 1:NP_001259930.1 Gene:CG3597 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001342858.1 Gene:SPAC26H5.09c PomBaseID:SPAC26H5.09c Length:369 Species:Schizosaccharomyces pombe

Alignment Length:205 Identity:56/206 (27%)
Similarity:92/206 (45%) Gaps:16/206 (8%)


  Fly    59 YDGFDALALDREVEVVYVGTLNPFHYAVVHLMLARGKNVLCETPMCLSVEQAKELYTLAEQRGVF 123
            |...|.|..|..:|:|.:......||.||...|..||:||||.|...:..:||||:.||:.:.:.
pombe    57 YTKLDELLADSNIELVVISLPPNVHYEVVSQALNAGKHVLCEKPFTPTYGEAKELFDLAKSKNLM 121

  Fly   124 LMEGNSMWSRFFPSYDRLRELLKNDVIGEVTQVKVQ----HGFRLAHMERVCNRSLGGSILMDIG 184
            |....:  .||...:...:|.::|..:|||.|.:..    ..||..:.:.|.|...|  ::.|:|
pombe   122 LTVYQN--RRFDGDFLTAKECIENGRLGEVVQFESHIDRFRLFRKGNWKDVPNPGCG--LVYDLG 182

  Fly   185 IYALQLGQFVFGV--SPVKILPSGTQLNKERVDVQIDFMLDY--GDGRRLVALVTGLEN----LE 241
            .:.:.....:||.  |....|.|..|:....|:.....:|.|  .:||..:.::....:    |:
pombe   183 SHLIDQAITLFGTPHSVTAKLESQRQIPPLEVEDCFRIVLHYLPQEGRLPLDVIVCSSSISCGLD 247

  Fly   242 NDAVITGTKG 251
            ...:|.||:|
pombe   248 MRYIIKGTRG 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 56/206 (27%)
GFO_IDH_MocA 7..127 CDD:279716 25/68 (37%)
GFO_IDH_MocA_C 142..228 CDD:304482 23/94 (24%)
SPAC26H5.09cNP_001342858.1 MviM 4..367 CDD:333017 56/206 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1924
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.