DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3597 and Blvra

Sequence 1:NP_001259930.1 Gene:CG3597 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_446302.1 Gene:Blvra RGDID:620721 Length:295 Species:Rattus norvegicus

Alignment Length:354 Identity:79/355 (22%)
Similarity:125/355 (35%) Gaps:107/355 (30%)


  Fly    10 GIAAAGRI---------TQDFVTALGTVEKSRHVVVAVADVDGQRAQQFAQRNQIPRHYDGFDAL 65
            |:..||.:         :..|:..:|.|  ||..:.::.:|               |.....|||
  Rat    15 GVGRAGSVRLRDLKDPRSAAFLNLIGFV--SRRELGSLDEV---------------RQISLEDAL 62

  Fly    66 ALDREVEVVYVGTLNPFHYAVVHLMLARGKNVLCETPMCLSVEQAKELYTLAEQRGVFLMEGN-- 128
            . .:|::|.|:.:.:..|...:...|..||:||.|.||.||...|:||:.||.|:|..|.|.:  
  Rat    63 R-SQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVE 126

  Fly   129 SMWSRFFPSYDRLRELLKNDVIGEVTQVKVQHGFRLAHMERVCNRSLGGSILMDIGIYALQLGQF 193
            .:...|        |.|:.:|:|:                                  .|..|..
  Rat   127 LLMEEF--------EFLRREVLGK----------------------------------ELLKGSL 149

  Fly   194 VFGVSPVKILPSGTQLNKERVDVQIDFMLDYGDGRRLVALVTGLENLENDAVITGTKGEIKLSNY 258
            .|..||         |.:||.....     :....||..||:....|   ::|:.|..|.|...|
  Rat   150 RFTASP---------LEEERFGFPA-----FSGISRLTWLVSLFGEL---SLISATLEERKEDQY 197

  Fly   259 WCCT-QISRSNAPPESW------PLPRAKF-DFHYTNTCGLRYEAEEVRRCIEKRLLESPKFTHA 315
            ...| |:...|....||      .|.|.:: :|.:|:  |...|...|.  :.|.:....:....
  Rat   198 MKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTS--GSLEEVPSVG--VNKNIFLKDQDIFV 258

  Fly   316 ESL-------ELAAIADEIRRQIGVVYDV 337
            :.|       :|||....|...:|:..|:
  Rat   259 QKLLDQVSAEDLAAEKKRIMHCLGLASDI 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 77/348 (22%)
GFO_IDH_MocA 7..127 CDD:279716 36/126 (29%)
GFO_IDH_MocA_C 142..228 CDD:304482 12/86 (14%)
BlvraNP_446302.1 GFO_IDH_MocA 18..124 CDD:279716 35/124 (28%)
MviM 57..>139 CDD:223745 29/91 (32%)
Biliv-reduc_cat 132..242 CDD:286275 34/171 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.