DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3597 and dhdh

Sequence 1:NP_001259930.1 Gene:CG3597 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001120637.1 Gene:dhdh XenbaseID:XB-GENE-5788276 Length:334 Species:Xenopus tropicalis

Alignment Length:329 Identity:129/330 (39%)
Similarity:188/330 (57%) Gaps:6/330 (2%)


  Fly     9 WGIAAAGRITQDFVTALGTVEKSRHVVVAVADVDGQRAQQFAQRNQIPRHYDGFDALALDREVEV 73
            |||.:.|:|:.||:.||.|:....|.|||||..|.::|:.|||..:||:.|..::.||.|..::|
 Frog     5 WGICSTGKISNDFLVALETLPAQDHQVVAVAARDLKQARDFAQIRKIPKAYGSYEELAKDPNIDV 69

  Fly    74 VYVGTLNPFHYAVVHLMLARGKNVLCETPMCLSVEQAKELYTLAEQRGVFLMEGNSMWSRFFPSY 138
            :|||.|:..|..||.:.|...||||||.|:.::..:.:||.:.|....||.||  ::||||||.|
 Frog    70 IYVGVLHTVHRDVVLMFLQNKKNVLCEKPLAMNSAEVQELTSAARAYNVFFME--ALWSRFFPVY 132

  Fly   139 DRLRELLKNDVIGEVTQVKVQHGFRLAHMERVCNRSLGGSILMDIGIYALQLGQFVF-GVSPVKI 202
            :::|.||..:.||:|..|:.:.|....|:.|...:.|||..|:|||.|.:|....|| |..|..:
 Frog   133 EQIRTLLSQNAIGDVKVVRAEFGSNQHHVPRAVQKELGGGALLDIGCYCIQFALMVFNGEKPESV 197

  Fly   203 LPSGTQLNKERVDVQIDFMLDYGDGRRLVALVTGLENLENDAVITGTKGEIKL-SNYWCCTQISR 266
            ...|. |....||..:..:|.|...|:.:...|.:..:.|.|.|.|:||.|:: |..||.|.:. 
 Frog   198 TAKGF-LYDTGVDETVTIILQYPGKRQAILTCTIMAAMPNQAAICGSKGMIQVPSCMWCPTSVI- 260

  Fly   267 SNAPPESWPLPRAKFDFHYTNTCGLRYEAEEVRRCIEKRLLESPKFTHAESLELAAIADEIRRQI 331
            .|.....:|||.:....|:||:.||.||||.||:|:.|.|.|||.....:|..|::|.||:|.|:
 Frog   261 VNGKETKFPLPHSTKPMHFTNSTGLSYEAEHVRQCLLKGLKESPIMRLKDSELLSSIMDEVRGQL 325

  Fly   332 GVVY 335
            ||.:
 Frog   326 GVKF 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3597NP_001259930.1 MviM 7..332 CDD:223745 127/325 (39%)
GFO_IDH_MocA 7..127 CDD:279716 50/118 (42%)
GFO_IDH_MocA_C 142..228 CDD:304482 29/87 (33%)
dhdhNP_001120637.1 MviM 1..302 CDD:223745 117/301 (39%)
GFO_IDH_MocA 4..121 CDD:279716 48/116 (41%)
GFO_IDH_MocA_C 136..>201 CDD:304482 23/65 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D351032at33208
OrthoFinder 1 1.000 FOG0001785
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1924
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.