DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and KLK10

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:253 Identity:73/253 - (28%)
Similarity:111/253 - (43%) Gaps:54/253 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ARSSN----GIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRV 73
            ||.|.    .::||:                .:| |.|.::|...|||||.| .|||   :..||
Human    53 ARGSQPWQVSLFNGL----------------SFH-CAGVLVDQSWVLTAAHC-GNKP---LWARV 96

  Fly    74 GTPD--IYRGGRIIRVTALVVHENY----------KNWDNDIALLWLEKPVL---SVRVTKIPLA 123
            |...  :.:|.::.|.|..|||..|          :..::|:.||.|.:||:   .||..::|..
Human    97 GDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYR 161

  Fly   124 TKEPSENEYPSNAGWGEKLLESYVVTRKLQ-NGVTKIRPRSMCAEELVEP--VGEELLCAFYTE- 184
            ..:|.:.  ...||||..........:.|. :.:|.:.|:. |  |:..|  |...::||.... 
Human   162 CAQPGDQ--CQVAGWGTTAARRVKYNKGLTCSSITILSPKE-C--EVFYPGVVTNNMICAGLDRG 221

  Fly   185 NDICPGDYGGPLVLANKVVGIAVQG-HGCGFAVLPSLYTNVFHYLEWIEENAEKLIKN 241
            .|.|..|.|||||....:.||...| :.||.|..|::||.:..|:.||    .|:|::
Human   222 QDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWI----NKVIRS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 68/234 (29%)
Tryp_SPc 19..231 CDD:214473 66/231 (29%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 71/248 (29%)
Tryp_SPc 49..269 CDD:214473 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.