Sequence 1: | NP_608665.1 | Gene: | CG4271 / 33410 | FlyBaseID: | FBgn0031409 | Length: | 242 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005568.2 | Gene: | LPA / 4018 | HGNCID: | 6667 | Length: | 2040 | Species: | Homo sapiens |
Alignment Length: | 239 | Identity: | 67/239 - (28%) |
---|---|---|---|
Similarity: | 97/239 - (40%) | Gaps: | 49/239 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 IYNGVEAKFDFWTFLASVWVS-GYHECGGAVIDSRIVLTAAQCVK--NKPVKRITVRVGTPDIYR 80
Fly 81 GGRI--IRVTALVVHENYKNWDNDIALLWLEKP-VLSVRVTKIPLATKEPSENEYPSNA------ 136
Fly 137 -GWGEK--------LLESYVVTRKLQNGVTKIRPRSMCAEELVEPVGEELLCAFYTENDICPGDY 192
Fly 193 GGPLVLANK----VVGIAVQGHGCGFAVLPSLYTNVFHYLEWIE 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4271 | NP_608665.1 | Tryp_SPc | 19..234 | CDD:238113 | 67/239 (28%) |
Tryp_SPc | 19..231 | CDD:214473 | 64/236 (27%) | ||
LPA | NP_005568.2 | Kringle | 28..105 | CDD:278480 | |
Kringle | 142..219 | CDD:278480 | |||
Kringle | 256..333 | CDD:278480 | |||
Kringle | 370..447 | CDD:278480 | |||
Kringle | 484..561 | CDD:278480 | |||
Kringle | 598..675 | CDD:278480 | |||
Kringle | 712..789 | CDD:278480 | |||
Kringle | 826..903 | CDD:278480 | |||
KR | 938..1019 | CDD:214527 | |||
Kringle | 1054..1131 | CDD:278480 | |||
KR | 1166..1246 | CDD:214527 | |||
KR | 1272..1352 | CDD:214527 | |||
KR | 1386..1466 | CDD:214527 | |||
KR | 1500..1581 | CDD:214527 | |||
KR | 1614..1695 | CDD:214527 | |||
Kringle | 1720..1799 | CDD:278480 | |||
Tryp_SPc | 1820..2034 | CDD:238113 | 65/237 (27%) | ||
Tryp_SPc | 1820..2033 | CDD:214473 | 64/236 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |