DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and CG32833

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:225 Identity:62/225 - (27%)
Similarity:102/225 - (45%) Gaps:27/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGRIIRVTALVVHENY 96
            ::||:.:....:|.||:.....::||.:||.....|.|.||||:.....|...:.|..:.|||.:
  Fly    51 WIASISIKQKAKCDGAIYKLSHIVTAGKCVDGFLNKVIRVRVGSTTRSDGVIEVAVCNITVHEKF 115

  Fly    97 KNWD--NDIALLWLEKPV-LSVRVTKIPLATKEPSE------NEYPSNAGWG---EKLL--ESYV 147
            ....  :::|:|.|.:|: .|..:..|.||.:.||.      |.:||...|.   :|.|  |:| 
  Fly   116 TGQTVFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGWPSFRWWAMYWKKCLDDEAY- 179

  Fly   148 VTRKLQNGVTKIRPRSMCAEELV------EPVGEELLCAFYTENDICPGDYGGPLVLANKVVGIA 206
               |||....|:...|.|.:...      :...::|.|......:.|....|.|:|...|:|||.
  Fly   180 ---KLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTEKFAKEACSLAMGSPVVHNGKLVGII 241

  Fly   207 VQGHGCGFAVLPSLYTNVFHYLEWIEENAE 236
            .:| ||  :..|.:|.|:..|.:|:..:.:
  Fly   242 TKG-GC--SEYPEVYINLIKYKDWLHNHTK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 62/221 (28%)
Tryp_SPc 19..231 CDD:214473 61/218 (28%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 62/221 (28%)
Tryp_SPc 40..262 CDD:214473 61/217 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.